Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Mouse anti-Human ERAP1 Monoclonal Antibody | anti-ERAP1 antibody

ERAP1 (Endoplasmic Reticulum Aminopeptidase 1, ARTS-1, Adipocyte-derived Leucine Aminopeptidase, A-LAP, Aminopeptidase PILS, Puromycin-insensitive Leucyl-specific Aminopeptidase, PILS-AP, Type 1 Tumor Necrosis Factor Receptor Shedding Aminopeptidase Regul

Gene Names
ERAP1; ALAP; A-LAP; ARTS1; ERAAP; APPILS; ARTS-1; ERAAP1; PILSAP; PILS-AP
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ERAP1; Monoclonal Antibody; ERAP1 (Endoplasmic Reticulum Aminopeptidase 1; ARTS-1; Adipocyte-derived Leucine Aminopeptidase; A-LAP; Aminopeptidase PILS; Puromycin-insensitive Leucyl-specific Aminopeptidase; PILS-AP; Type 1 Tumor Necrosis Factor Receptor Shedding Aminopeptidase Regul; anti-ERAP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4H8
Specificity
Recognizes human ARTS-1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
3292
Applicable Applications for anti-ERAP1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa832-942 from human ARTS-1 (AAH30775) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FPQILTLIGRNPVGYPLAWQFLRKNWNKLVQKFELGSSSIAHMVMGTTNQFSTRTRLEEVKGFFSSLKENGSQLRCVQQTIETIEENIGWMDKNFDKIRVWLQSEKLERM
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB)

(ARTS-1 monoclonal antibody, Western Blot analysis of ARTS-1 expression in A-431.)

Western Blot (WB) (ARTS-1 monoclonal antibody, Western Blot analysis of ARTS-1 expression in A-431.)

Testing Data

(Detection limit for recombinant GST tagged ERAP1 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ERAP1 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-ERAP1 antibody
ARTS1/Adipocyte-derived leucine aminopeptidase (A-LAP) is a member of the M1 family of zinc metallopeptidases. A-LAP is upregulatable by gamma interferon and trims N-terminal lysine, leucine, tyrosine and asparagines residues when they are not followed by proline in the ER to yield the optimal octamer, primarily and nonamer peptides for antigen presentation by major histocompatibility complex (MHC) molecules. It may also play a role in the inactivation of peptide hormones and may be involved in the regulation of blood pressure through the inactivation of angiotensin II and/or the generation of bradykinin in the kidney.
Product Categories/Family for anti-ERAP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens endoplasmic reticulum aminopeptidase 1, mRNA
NCBI Official Synonym Full Names
endoplasmic reticulum aminopeptidase 1
NCBI Official Symbol
ERAP1
NCBI Official Synonym Symbols
ALAP; A-LAP; ARTS1; ERAAP; APPILS; ARTS-1; ERAAP1; PILSAP; PILS-AP
NCBI Protein Information
endoplasmic reticulum aminopeptidase 1

NCBI Description

The protein encoded by this gene is an aminopeptidase involved in trimming HLA class I-binding precursors so that they can be presented on MHC class I molecules. The encoded protein acts as a monomer or as a heterodimer with ERAP2. This protein may also be involved in blood pressure regulation by inactivation of angiotensin II. Three transcript variants encoding two different isoforms have been found for this gene.[provided by RefSeq, Oct 2010]

Research Articles on ERAP1

Similar Products

Product Notes

The ERAP1 (Catalog #AAA6136460) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ERAP1 (Endoplasmic Reticulum Aminopeptidase 1, ARTS-1, Adipocyte-derived Leucine Aminopeptidase, A-LAP, Aminopeptidase PILS, Puromycin-insensitive Leucyl-specific Aminopeptidase, PILS-AP, Type 1 Tumor Necrosis Factor Receptor Shedding Aminopeptidase Regul reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ERAP1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ERAP1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ERAP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.