Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse anti-Human DAG1 Monoclonal Antibody | anti-DAG1 antibody

DAG1 (Dystroglycan, Dystrophin-associated Glycoprotein 1, Alpha-dystroglycan, alpha-DG) APC

Gene Names
DAG1; A3a; DAG; AGRNR; 156DAG; MDDGA9; MDDGC7; MDDGC9
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DAG1; Monoclonal Antibody; DAG1 (Dystroglycan; Dystrophin-associated Glycoprotein 1; Alpha-dystroglycan; alpha-DG) APC; anti-DAG1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2A3
Specificity
Recognizes human DAG1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-DAG1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa31-140 from human DAG1 (AAH12740) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
WPSEPSEAVRDWENQLEASMHSVLSDLHEAVPTVVGIPDGTAVVGRSFRVTIPTDLIASSGDIIKVSAAGKEALPSWLHWDSQSHTLEGLPLDTDKGVHYISVSATRLGA
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Testing Data

(Detection limit for recombinant GST tagged DAG1 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged DAG1 is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-DAG1 antibody
The dystroglycan complex is involved in a number of processes including laminin and basement membrane assembly, sarcolemmal stability, cell survival, peripheral nerve myelination, nodal structure, cell migration, and epithelial polarization.
Product Categories/Family for anti-DAG1 antibody
References
1. The N-terminal domain of ?-dystroglycan, released as a 38kDa protein, is increased in cerebrospinal fluid in patients with Lyme neuroborreliosis. Hesse C, Johansson I, Mattsson N, Bremell D, Andreasson U, Halim A, Anckarsater R, Blennow K, Anckarsater H, Zetterberg H, Larson G, Hagberg L, Grahn A.Biochem Biophys Res Commun. 2011 Sep 2;412(3):494-9. Epub 2011 Aug 6.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
97,441 Da
NCBI Official Full Name
Homo sapiens dystroglycan 1 (dystrophin-associated glycoprotein 1), mRNA
NCBI Official Synonym Full Names
dystroglycan 1
NCBI Official Symbol
DAG1
NCBI Official Synonym Symbols
A3a; DAG; AGRNR; 156DAG; MDDGA9; MDDGC7; MDDGC9
NCBI Protein Information
dystroglycan
Protein Family

NCBI Description

This gene encodes dystroglycan, a central component of dystrophin-glycoprotein complex that links the extracellular matrix and the cytoskeleton in the skeletal muscle. The encoded preproprotein undergoes O- and N-glycosylation, and proteolytic processing to generate alpha and beta subunits. Certain mutations in this gene are known to cause distinct forms of muscular dystrophy. Alternative splicing results in multiple transcript variants, all encoding the same protein. [provided by RefSeq, Nov 2015]

Research Articles on DAG1

Similar Products

Product Notes

The DAG1 (Catalog #AAA6136156) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DAG1 (Dystroglycan, Dystrophin-associated Glycoprotein 1, Alpha-dystroglycan, alpha-DG) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DAG1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DAG1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DAG1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.