Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human COG2 Monoclonal Antibody | anti-COG2 antibody

COG2 (LDLC, Conserved Oligomeric Golgi Complex Subunit 2, Component of Oligomeric Golgi Complex 2, Low Density Lipoprotein Receptor Defect C-complementing Protein) APC

Gene Names
COG2; LDLC; CDG2Q
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
COG2; Monoclonal Antibody; COG2 (LDLC; Conserved Oligomeric Golgi Complex Subunit 2; Component of Oligomeric Golgi Complex 2; Low Density Lipoprotein Receptor Defect C-complementing Protein) APC; anti-COG2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4C8
Specificity
Recognizes human COG2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-COG2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa639-739 from COG2 (NP_031383) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LSESTHKYYETVSDVLNSVKKMEESLKRLKQARKTTPANPVGPSGGMSDDDKIRLQLALDVEYLGEQIQKLGLQASDIKSFSALAELVAAAKDQATAEQP*
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(Western Blot analysis of COG2 expression in transfected 293T cell line by COG2 monoclonal antibody. Lane 1: COG2 transfected lysate (83.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of COG2 expression in transfected 293T cell line by COG2 monoclonal antibody. Lane 1: COG2 transfected lysate (83.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB)

(Western blot analysis of COG2 over-expressed 293 cell line, cotransfected with COG2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with COG2 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of COG2 over-expressed 293 cell line, cotransfected with COG2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with COG2 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)
Product Categories/Family for anti-COG2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
83kDa
NCBI Official Full Name
conserved oligomeric Golgi complex subunit 2 isoform 1
NCBI Official Synonym Full Names
component of oligomeric golgi complex 2
NCBI Official Symbol
COG2
NCBI Official Synonym Symbols
LDLC; CDG2Q
NCBI Protein Information
conserved oligomeric Golgi complex subunit 2
UniProt Protein Name
Conserved oligomeric Golgi complex subunit 2
UniProt Gene Name
COG2
UniProt Synonym Gene Names
LDLC; COG complex subunit 2
UniProt Entry Name
COG2_HUMAN

NCBI Description

This gene encodes a subunit of the conserved oligomeric Golgi complex that is required for maintaining normal structure and activity of the Golgi complex. The encoded protein specifically interacts with the USO1 vesicle docking protein and may be necessary for normal Golgi ribbon formation and trafficking of Golgi enzymes. Mutations of this gene are associated with abnormal glycosylation within the Golgi apparatus. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Feb 2009]

Uniprot Description

COG2: Required for normal Golgi morphology and function. Belongs to the COG2 family. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 1q42.2

Cellular Component: Golgi membrane; Golgi stack; Golgi transport complex; cytosol

Molecular Function: protein binding; protein complex binding; protein transporter activity

Biological Process: intracellular protein transport; intra-Golgi vesicle-mediated transport; oligosaccharide biosynthetic process; protein amino acid glycosylation; Golgi organization and biogenesis

Research Articles on COG2

Similar Products

Product Notes

The COG2 cog2 (Catalog #AAA6135977) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The COG2 (LDLC, Conserved Oligomeric Golgi Complex Subunit 2, Component of Oligomeric Golgi Complex 2, Low Density Lipoprotein Receptor Defect C-complementing Protein) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's COG2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the COG2 cog2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "COG2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.