Western Blot (WB)
(Western Blot detection against Immunogen (37kD).)
Mouse anti-Human CDKL4 Monoclonal Antibody | anti-CDKL4 antibody
CDKL4 (Cyclin-dependent Kinase-like 4) APC
Gene Names
LRRK2; PARK8; RIPK7; ROCO2; AURA17; DARDARIN
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CDKL4; Monoclonal Antibody; CDKL4 (Cyclin-dependent Kinase-like 4) APC; anti-CDKL4 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5G3
Specificity
Recognizes human CDKL4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
2527
Applicable Applications for anti-CDKL4 antibody
ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Sandwich ELISA: The detection limit is ~0.03ng/ml as a capture antibody
Applications are based on unconjugated antibody.
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa196-295 from human CDKL4 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TGQPLWPGKSDVDQLYLIIRTLGKLIPRHQSIFKSNGFFHGISIPEPEDMETLEEKFSDVHPVALNFMKGCLKMNPDDRLTCSQLLESSYFDSFQEAQIK
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (37kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (37kD).)
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to CDKL4 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3ug/ml].)
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to CDKL4 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3ug/ml].)
Testing Data
(Detection limit for recombinant GST tagged CDKL4 is ~0.03ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged CDKL4 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-CDKL4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
leucine-rich repeat kinase 2
NCBI Official Synonym Full Names
leucine rich repeat kinase 2
NCBI Official Symbol
LRRK2
NCBI Official Synonym Symbols
PARK8; RIPK7; ROCO2; AURA17; DARDARIN
NCBI Protein Information
leucine-rich repeat serine/threonine-protein kinase 2
Protein Family
NCBI Description
This gene is a member of the leucine-rich repeat kinase family and encodes a protein with an ankryin repeat region, a leucine-rich repeat (LRR) domain, a kinase domain, a DFG-like motif, a RAS domain, a GTPase domain, a MLK-like domain, and a WD40 domain. The protein is present largely in the cytoplasm but also associates with the mitochondrial outer membrane. Mutations in this gene have been associated with Parkinson disease-8. [provided by RefSeq, Jul 2008]
Research Articles on CDKL4
Similar Products
Product Notes
The CDKL4 (Catalog #AAA6135824) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CDKL4 (Cyclin-dependent Kinase-like 4) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDKL4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB). Sandwich ELISA: The detection limit is ~0.03ng/ml as a capture antibody Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CDKL4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CDKL4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
