Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (48.29kD).)

Mouse anti-Human CD83 Monoclonal Antibody | anti-CD83 antibody

CD83 (CD83 Antigen, CD83 Molecule, B cell Activation Protein, BL11, Cell Surface Protein HB15, HB15) APC

Gene Names
CD83; BL11; HB15
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CD83; Monoclonal Antibody; CD83 (CD83 Antigen; CD83 Molecule; B cell Activation Protein; BL11; Cell Surface Protein HB15; HB15) APC; anti-CD83 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3G10-1F4
Specificity
Recognizes human CD83.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-CD83 antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-205 from CD83 (AAH30830) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELV
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (48.29kD).)

Western Blot (WB) (Western Blot detection against Immunogen (48.29kD).)

Western Blot (WB)

(CD83 monoclonal antibody Western Blot analysis of CD83 expression in human colon.)

Western Blot (WB) (CD83 monoclonal antibody Western Blot analysis of CD83 expression in human colon.)

Western Blot (WB)

(Western Blot analysis of CD83 expression in transfected 293T cell line by CD83 monoclonal antibody. Lane 1: CD83 transfected lysate (Predicted MW: 23kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CD83 expression in transfected 293T cell line by CD83 monoclonal antibody. Lane 1: CD83 transfected lysate (Predicted MW: 23kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of CD83 transfected lysate using CD83 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with CD83 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of CD83 transfected lysate using CD83 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with CD83 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged CD83 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CD83 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-CD83 antibody
CD83 is a 45kD type I transmembrane protein. It belongs to immunoglobulin superfamily and is expressed on mature dendritic cells and activated lymphocytes. CD83 is involved in the regulation of T cell development and immune response. Soluble form CD83 has been reported to inhibit dendritic cell maturation and dendritic cell-mediated T cell proliferation. Murine CD83 ligand has been found on B cells.
Product Categories/Family for anti-CD83 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
23,042 Da
NCBI Official Full Name
Homo sapiens CD83 molecule, mRNA
NCBI Official Synonym Full Names
CD83 molecule
NCBI Official Symbol
CD83
NCBI Official Synonym Symbols
BL11; HB15
NCBI Protein Information
CD83 antigen
Protein Family

NCBI Description

The protein encoded by this gene is a single-pass type I membrane protein and member of the immunoglobulin superfamily of receptors. The encoded protein may be involved in the regulation of antigen presentation. A soluble form of this protein can bind to dendritic cells and inhibit their maturation. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]

Research Articles on CD83

Similar Products

Product Notes

The CD83 (Catalog #AAA6135779) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CD83 (CD83 Antigen, CD83 Molecule, B cell Activation Protein, BL11, Cell Surface Protein HB15, HB15) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD83 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CD83 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD83, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.