Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunoprecipitation (IP) (Immunoprecipitation of CD69 transfected lysate using CD69 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with CD69 rabbit polyclonal antibody.)

Mouse anti-Human CD69 Monoclonal Antibody | anti-CD69 antibody

CD69 (Activation Inducer Molecule, AIM, BLAC/P26, CLEC2C, EA1, Early Activation Antigen CD69, Early T cell Activation Antigen p60, GP32/28, Leu23, MLR-3) APC

Gene Names
CD69; AIM; EA1; MLR-3; CLEC2C; GP32/28; BL-AC/P26
Reactivity
Human
Applications
ELISA, Immunoprecipitation
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CD69; Monoclonal Antibody; CD69 (Activation Inducer Molecule; AIM; BLAC/P26; CLEC2C; EA1; Early Activation Antigen CD69; Early T cell Activation Antigen p60; GP32/28; Leu23; MLR-3) APC; anti-CD69 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4H3
Specificity
Recognizes human CD69.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
1701
Applicable Applications for anti-CD69 antibody
ELISA (EIA), Immunoprecipitation (IP)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa90-199 from human CD69 (AAH07037) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunoprecipitation (IP)

(Immunoprecipitation of CD69 transfected lysate using CD69 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with CD69 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of CD69 transfected lysate using CD69 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with CD69 rabbit polyclonal antibody.)
Related Product Information for anti-CD69 antibody
The CD69 cell surface antigen, also known as activation inducer molecule (AIM), is expressed as an early activation marker on T and B lymphocytes.
Product Categories/Family for anti-CD69 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
969
NCBI Official Full Name
Homo sapiens CD69 molecule, mRNA
NCBI Official Synonym Full Names
CD69 molecule
NCBI Official Symbol
CD69
NCBI Official Synonym Symbols
AIM; EA1; MLR-3; CLEC2C; GP32/28; BL-AC/P26
NCBI Protein Information
early activation antigen CD69
Protein Family

NCBI Description

This gene encodes a member of the calcium dependent lectin superfamily of type II transmembrane receptors. Expression of the encoded protein is induced upon activation of T lymphocytes, and may play a role in proliferation. Furthermore, the protein may act to transmit signals in natural killer cells and platelets. [provided by RefSeq, Aug 2011]

Research Articles on CD69

Similar Products

Product Notes

The CD69 (Catalog #AAA6135773) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CD69 (Activation Inducer Molecule, AIM, BLAC/P26, CLEC2C, EA1, Early Activation Antigen CD69, Early T cell Activation Antigen p60, GP32/28, Leu23, MLR-3) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD69 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CD69 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD69, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.