Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (34.87kD).)

Mouse anti-Human Caveolin 3 Monoclonal Antibody | anti-CAV3 antibody

Caveolin 3 (Caveolin-3, CAV3, M-caveolin) APC

Gene Names
CAV3; LQT9; VIP21; LGMD1C; VIP-21
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Caveolin 3; Monoclonal Antibody; Caveolin 3 (Caveolin-3; CAV3; M-caveolin) APC; anti-CAV3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1G11
Specificity
Recognizes human CAV3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-CAV3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-83 from human CAV3 (NP_001225) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKVSYTTFTVSKYWCYRLLSTLLGVP
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.87kD).)

Western Blot (WB) (Western Blot detection against Immunogen (34.87kD).)

Testing Data

(Detection limit for recombinant GST tagged CAV3 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CAV3 is ~1ng/ml as a capture antibody.)
Related Product Information for anti-CAV3 antibody
Caveolin proteins are components of caveolae plasma membranes found in most cell types. Caveolin-3 is the muscle-specific form of the caveolin protein family whose members are proposed to be scaffolding proteins for organizing and concentrating certain caveolin-interacting molecules within the caveolae membranes. Mutations in caveolin-3 have been isolated which interfere with caveolin-3 oligomerization and disrupt caveolae formation resulting in limb-girdle muscular dystrophy.
Product Categories/Family for anti-CAV3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
859
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17,259 Da
NCBI Official Full Name
caveolin-3
NCBI Official Synonym Full Names
caveolin 3
NCBI Official Symbol
CAV3
NCBI Official Synonym Symbols
LQT9; VIP21; LGMD1C; VIP-21
NCBI Protein Information
caveolin-3; M-caveolin
UniProt Protein Name
Caveolin-3
Protein Family
UniProt Gene Name
CAV3
UniProt Entry Name
CAV3_HUMAN

Uniprot Description

caveolin-3: May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. May also regulate voltage-gated potassium channels. Plays a role in the sarcolemma repair mechanism of both skeletal muscle and cardiomyocytes that permits rapid resealing of membranes disrupted by mechanical stress. Defects in CAV3 are the cause of limb-girdle muscular dystrophy type 1C (LGMD1C). LGMD1C is a myopathy characterized by calf hypertrophy and mild to moderate proximal muscle weakness. LGMD1C inheritance can be autosomal dominant or recessive. Defects in CAV3 are a cause of hyperCKmia (HYPCK). It is a disease characterized by persistent elevated levels of serum creatine kinase without muscle weakness. Defects in CAV3 are a cause of rippling muscle disease (RMD). RMD is a rare disorder characterized by mechanically triggered contractions of skeletal muscle. In RMD, mechanical stimulation leads to electrically silent muscle contractions that spread to neighboring fibers that cause visible ripples to move over the muscle. Defects in CAV3 are a cause of familial hypertrophic cardiomyopathy (CMH); also designated FHC or HCM. Familial hypertrophic cardiomyopathy is a hereditary heart disorder characterized by ventricular hypertrophy, which is usually asymmetric and often involves the interventricular septum. The symptoms include dyspnea, syncope, collapse, palpitations, and chest pain. They can be readily provoked by exercise. The disorder has inter- and intrafamilial variability ranging from benign to malignant forms with high risk of cardiac failure and sudden cardiac death. Defects in CAV3 are the cause of long QT syndrome type 9 (LQT9). Long QT syndromes are heart disorders characterized by a prolonged QT interval on the ECG and polymorphic ventricular arrhythmias. They cause syncope and sudden death in response to excercise or emotional stress. They can present with a sentinel event of sudden cardiac death in infancy. Defects in CAV3 can be a cause of sudden infant death syndrome (SIDS). SIDS is the sudden death of an infant younger than 1 year that remains unexplained after a thorough case investigation, including performance of a complete autopsy, examination of the death scene, and review of clinical history. Pathophysiologic mechanisms for SIDS may include respiratory dysfunction, cardiac dysrhythmias, cardiorespiratory instability, and inborn errors of metabolism, but definitive pathogenic mechanisms precipitating an infant sudden death remain elusive. Long QT syndromes-associated mutations can be responsible for some SIDS cases. Defects in CAV3 are the cause of myopathy distal Tateyama type (MPDT). A disorder characterized by progressive muscular atrophy and muscle weakness beginning in the hands, the legs, or the feet. Muscle atrophy may be restricted to the small muscles of the hands and feet. Belongs to the caveolin family.

Protein type: Dystrophin complex; Extracellular matrix; Motility/polarity/chemotaxis; Cell development/differentiation

Chromosomal Location of Human Ortholog: 3p25

Cellular Component: Golgi membrane; dystrophin-associated glycoprotein complex; cell surface; endoplasmic reticulum; T-tubule; plasma membrane; caveola; Z disc; neuromuscular junction; sarcolemma; vesicle; lipid raft

Molecular Function: protein C-terminus binding; protein binding; sodium channel regulator activity; calcium channel regulator activity; protein complex binding; protein complex scaffold; nitric-oxide synthase binding; potassium channel inhibitor activity; alpha-tubulin binding

Biological Process: negative regulation of MAP kinase activity; muscle development; positive regulation of microtubule polymerization; T-tubule organization and biogenesis; negative regulation of cell size; glucose homeostasis; cytoplasmic microtubule organization and biogenesis; regulation of heart contraction; muscle maintenance; protein localization; elevation of cytosolic calcium ion concentration; cardiac muscle cell development; regulation of transforming growth factor beta receptor signaling pathway; plasma membrane organization and biogenesis; regulation of skeletal muscle contraction; positive regulation of cell proliferation; cell growth; cell differentiation; myoblast fusion; regulation of nerve growth factor receptor activity; negative regulation of calcium ion transport; negative regulation of nitric-oxide synthase activity; negative regulation of MAPKKK cascade; regulation of heart rate; actin filament organization; endocytosis; regulation of protein kinase B signaling cascade; nucleus localization; cholesterol homeostasis; regulation of membrane potential; triacylglycerol metabolic process; plasma membrane repair; negative regulation of protein kinase activity; lipid raft organization and biogenesis

Disease: Creatine Phosphokinase, Elevated Serum; Long Qt Syndrome 9; Rippling Muscle Disease; Muscular Dystrophy, Limb-girdle, Type 1c; Myopathy, Distal, Tateyama Type; Cardiomyopathy, Familial Hypertrophic, 1

Similar Products

Product Notes

The CAV3 cav3 (Catalog #AAA6135680) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Caveolin 3 (Caveolin-3, CAV3, M-caveolin) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Caveolin 3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CAV3 cav3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Caveolin 3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.