Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human CACNB1 Monoclonal Antibody | anti-CACNB1 antibody

CACNB1 (Voltage-dependent L-type Calcium Channel Subunit beta-1, CAB1, Calcium Channel Voltage-dependent Subunit beta 1, CACNLB1) APC

Gene Names
CACNB1; CAB1; CCHLB1; CACNLB1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CACNB1; Monoclonal Antibody; CACNB1 (Voltage-dependent L-type Calcium Channel Subunit beta-1; CAB1; Calcium Channel Voltage-dependent Subunit beta 1; CACNLB1) APC; anti-CACNB1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1G6
Specificity
Recognizes human CACNB1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-CACNB1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa500-598 from human CACNB1 (NP_000714) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FDADTPGSRNSAYTELGDSCVDMETDPSEGPGLGDPAGGGTPPARQGSWEDEEEDYEEELTDNRNRGRNKARYCAEGGGPVLGRNKNELEGWGRGVYIR
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(Western Blot analysis of CACNB1 expression in transfected 293T cell line by CACNB1 monoclonal antibody. Lane 1: CACNB1 transfected lysate (65.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CACNB1 expression in transfected 293T cell line by CACNB1 monoclonal antibody. Lane 1: CACNB1 transfected lysate (65.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB)

(Western blot analysis of CACNB1 over-expressed 293 cell line, cotransfected with CACNB1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CACNB1 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of CACNB1 over-expressed 293 cell line, cotransfected with CACNB1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CACNB1 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Related Product Information for anti-CACNB1 antibody
The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.
Product Categories/Family for anti-CACNB1 antibody
References
1. The {beta}1 subunit of L-type voltage-gated Ca2+ channels independently binds to and inhibits the gating of large-conductance Ca2+-activated K+ channels. Zou S, Jha S, Kim EY, Dryer SE.Mol Pharmacol. 2008 Feb;73(2):369-78. Epub 2007 Nov 7.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
782
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53,006 Da
NCBI Official Full Name
voltage-dependent L-type calcium channel subunit beta-1 isoform 1
NCBI Official Synonym Full Names
calcium channel, voltage-dependent, beta 1 subunit
NCBI Official Symbol
CACNB1
NCBI Official Synonym Symbols
CAB1; CCHLB1; CACNLB1
NCBI Protein Information
voltage-dependent L-type calcium channel subunit beta-1; calcium channel voltage-dependent subunit beta 1; calcium channel, L type, beta 1 polypeptide; dihydropyridine-sensitive L-type, calcium channel beta-1 subunit
UniProt Protein Name
Voltage-dependent L-type calcium channel subunit beta-1
UniProt Gene Name
CACNB1
UniProt Synonym Gene Names
CACNLB1; CAB1
UniProt Entry Name
CACB1_HUMAN

Uniprot Description

CACNB1: The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting. Belongs to the calcium channel beta subunit family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Channel, calcium

Chromosomal Location of Human Ortholog: 17q21-q22

Cellular Component: sarcoplasmic reticulum; T-tubule; voltage-gated calcium channel complex

Molecular Function: voltage-gated calcium channel activity; high voltage-gated calcium channel activity

Biological Process: synaptic transmission; axon guidance; transport; protein targeting to membrane; neuromuscular junction development

Similar Products

Product Notes

The CACNB1 cacnb1 (Catalog #AAA6135619) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CACNB1 (Voltage-dependent L-type Calcium Channel Subunit beta-1, CAB1, Calcium Channel Voltage-dependent Subunit beta 1, CACNLB1) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CACNB1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CACNB1 cacnb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CACNB1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.