Mouse anti-Human ACVR1C Monoclonal Antibody | anti-ACVR1C antibody

ACVR1C (Activin Receptor Type-IC, Activin Receptor Type 1C, ACTR-IC, Activin Receptor-like Kinase 7, ALK-7, ALK7) APC

Cat. Num. AAA6135169

• Gene Names: ACVR1C; ALK7; ACVRLK7
• Reactivity: Human
• Applications: ELISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ACVR1C; Monoclonal Antibody; ACVR1C (Activin Receptor Type-IC; Activin Receptor Type 1C; ACTR-IC; Activin Receptor-like Kinase 7; ALK-7; ALK7) APC; anti-ACVR1C antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2E3
• Specificity: Recognizes human ACVR1C.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-ACVR1C antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa23-112 from human ACVR1C (AAH22530) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPM
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between INHBB and ACVR1C. HeLa cells were stained with INHBB rabbit purified polyclonal 1:1200 and ACVR1C mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Related Product Information for anti-ACVR1C antibody

ACVR1C, a serine/threonine protein kinase, is a type I receptor for the TGFB family of signaling molecules. The receptor complex consisting of 2 type II and 2 type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators, SMAD2 and SMAD3, which then translocate to the nucleus and interact directly with DNA or in complex with other transcription factors. ACVR1C is a receptor for activin AB, activin B and NODAL. This protein plays a role in cell differentiation, growth arrest and apoptosis.

Product Categories/Family for anti-ACVR1C antibody

Antibodies; Activin Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 18490924
• NCBI GeneID: 130399
• UniProt Accession #: Q8NER5; Q4ZFZ8; Q86UL1; Q86UL2; Q8TBG2
• Molecular Weight: ~68 kDa
• NCBI Official Full Name: Homo sapiens activin A receptor, type IC, mRNA
• NCBI Official Synonym Full Names: activin A receptor, type IC
• NCBI Official Symbol: ACVR1C
• NCBI Official Synonym Symbols: ALK7; ACVRLK7
• NCBI Protein Information: activin receptor type-1C; ALK-7; ACTR-IC; activin receptor type IC; activin receptor-like kinase 7
• UniProt Protein Name: Activin receptor type-1C
• Protein Family: Activin receptor
• UniProt Gene Name: ACVR1C
• UniProt Synonym Gene Names: ALK7; ACTR-IC; ALK-7
• UniProt Entry Name: ACV1C_HUMAN

NCBI Description

ACVR1C is a type I receptor for the TGFB (see MIM 190180) family of signaling molecules. Upon ligand binding, type I receptors phosphorylate cytoplasmic SMAD transcription factors, which then translocate to the nucleus and interact directly with DNA or in complex with other transcription factors (Bondestam et al., 2001 [PubMed 12063393]).[supplied by OMIM, Mar 2008]

Uniprot Description

ALK7: Serine/threonine protein kinase which forms a receptor complex on ligand binding. The receptor complex consisting of 2 type II and 2 type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators, SMAD2 and SMAD3. Receptor for activin AB, activin B and NODAL. Plays a role in cell differentiation, growth arrest and apoptosis. Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Protein kinase, TKL; Protein kinase, Ser/Thr (receptor); Membrane protein, integral; Kinase, protein; EC 2.7.11.30; TKL group; STKR family; Type1 subfamily

Chromosomal Location of Human Ortholog: 2q24.1

Cellular Component: plasma membrane; activin receptor complex

Molecular Function: transforming growth factor beta receptor activity; activin receptor activity, type I; growth factor binding; metal ion binding; ATP binding; receptor signaling protein serine/threonine kinase activity

Biological Process: response to dietary excess; sequestering of lipid; apoptotic nuclear changes; response to glucose stimulus; positive regulation of caspase activity; cell differentiation; protein amino acid phosphorylation; response to insulin stimulus; negative regulation of insulin secretion