Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (45.47kD).)

Mouse anti-Human VPS25 Monoclonal Antibody | anti-VPS25 antibody

VPS25 (Vacuolar Protein-sorting-associated Protein 25, hVps25, Dermal Papilla-derived Protein 9, DERP9, ELL-associated Protein of 20kD, EAP20, ESCRT-II Complex Subunit VPS25) (AP)

Gene Names
VPS25; DERP9; EAP20; FAP20
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
VPS25; Monoclonal Antibody; VPS25 (Vacuolar Protein-sorting-associated Protein 25; hVps25; Dermal Papilla-derived Protein 9; DERP9; ELL-associated Protein of 20kD; EAP20; ESCRT-II Complex Subunit VPS25) (AP); anti-VPS25 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2E5-2B9
Specificity
Recognizes human MGC10540.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-VPS25 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-177 from human MGC10540 (AAH06282) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (45.47kD).)

Western Blot (WB) (Western Blot detection against Immunogen (45.47kD).)

Western Blot (WB)

(MGC10540 monoclonal antibody, Western Blot analysis of MGC10540 expression in Hela NE.)

Western Blot (WB) (MGC10540 monoclonal antibody, Western Blot analysis of MGC10540 expression in Hela NE.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to VPS25 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to VPS25 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged VPS25 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged VPS25 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-VPS25 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
20,748 Da
NCBI Official Full Name
Homo sapiens vacuolar protein sorting 25 homolog (S. cerevisiae), mRNA
NCBI Official Synonym Full Names
vacuolar protein sorting 25 homolog
NCBI Official Symbol
VPS25
NCBI Official Synonym Symbols
DERP9; EAP20; FAP20
NCBI Protein Information
vacuolar protein-sorting-associated protein 25

NCBI Description

This gene encodes a protein that is a subunit of the endosomal sorting complex required for transport II (ESCRT-II). This protein complex functions in sorting of ubiquitinated membrane proteins during endocytosis. A pseudogene of this gene is present on chromosome 1. [provided by RefSeq, Jul 2013]

Research Articles on VPS25

Similar Products

Product Notes

The VPS25 (Catalog #AAA6134510) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The VPS25 (Vacuolar Protein-sorting-associated Protein 25, hVps25, Dermal Papilla-derived Protein 9, DERP9, ELL-associated Protein of 20kD, EAP20, ESCRT-II Complex Subunit VPS25) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's VPS25 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the VPS25 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "VPS25, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.