Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (60.1kD).)

Mouse anti-Human TOMM34 Monoclonal Antibody | anti-TOMM34 antibody

TOMM34 (Translocase of Outer Membrane 34kD Subunit, Mitochondrial Import Receptor Subunit TOM34, hTom34, HTOM34P, URCC3) (AP)

Gene Names
TOMM34; TOM34; URCC3; HTOM34P
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TOMM34; Monoclonal Antibody; TOMM34 (Translocase of Outer Membrane 34kD Subunit; Mitochondrial Import Receptor Subunit TOM34; hTom34; HTOM34P; URCC3) (AP); anti-TOMM34 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B5
Specificity
Recognizes human TOMM34.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-TOMM34 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-310 from human TOMM34 (AAH01763) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAPKFPDSVEELRAAGNESFRNGQYAEASALYGRALRVLQAQGSSDPEEESVLYSNRAACHLKDGNCRDCIKDCTSALALVPFSIKPLLRRASAYEALEKYPMAYVDYKTVLQIDDNVTSAVEGINRMTRALMDSLGPEWRLKLPSIPLVPVSAQKRWNSLPSENHKEMAKSKSKETTATKNRVPSAGDVEKARVLKEEGNELVKKGNHKKAIEKYSESLLCSNLESATYSNRALCYLVLKQYTEAVKDCTEALKLDGKNVKAFYRRAQAHKALKDYKSSFADISNLLQIEPRNGPAQKLRQEVKQNLH
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (60.1kD).)

Western Blot (WB) (Western Blot detection against Immunogen (60.1kD).)

Western Blot (WB)

(TOMM34 monoclonal antibody Western Blot analysis of TOMM34 expression in Hela.)

Western Blot (WB) (TOMM34 monoclonal antibody Western Blot analysis of TOMM34 expression in Hela.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TOMM34 on HeLa cell. [antibody concentration 30ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to TOMM34 on HeLa cell. [antibody concentration 30ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged TOMM34 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TOMM34 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-TOMM34 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
34,559 Da
NCBI Official Full Name
Homo sapiens translocase of outer mitochondrial membrane 34, mRNA
NCBI Official Synonym Full Names
translocase of outer mitochondrial membrane 34
NCBI Official Symbol
TOMM34
NCBI Official Synonym Symbols
TOM34; URCC3; HTOM34P
NCBI Protein Information
mitochondrial import receptor subunit TOM34

NCBI Description

The protein encoded by this gene is involved in the import of precursor proteins into mitochondria. The encoded protein has a chaperone-like activity, binding the mature portion of unfolded proteins and aiding their import into mitochondria. This protein, which is found in the cytoplasm and sometimes associated with the outer mitochondrial membrane, has a weak ATPase activity and contains 6 TPR repeats. [provided by RefSeq, Jul 2008]

Research Articles on TOMM34

Similar Products

Product Notes

The TOMM34 (Catalog #AAA6134269) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TOMM34 (Translocase of Outer Membrane 34kD Subunit, Mitochondrial Import Receptor Subunit TOM34, hTom34, HTOM34P, URCC3) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TOMM34 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TOMM34 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TOMM34, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.