Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (STAT6 monoclonal antibody, Western Blot analysis of STAT6 expression in HeLa.)

Mouse anti-Human STAT6 Monoclonal Antibody | anti-STAT6 antibody

STAT6 (Signal Transducer and Activator of Transcription 6, IL-4 Stat) (AP)

Gene Names
STAT6; STAT6B; STAT6C; D12S1644; IL-4-STAT
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
STAT6; Monoclonal Antibody; STAT6 (Signal Transducer and Activator of Transcription 6; IL-4 Stat) (AP); anti-STAT6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
6C10
Specificity
Recognizes human STAT6.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-STAT6 antibody
ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa695-804 from human STAT6 (NP_003144) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PHSHSIPPYQGLSPEESVNVLSAFQEPHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLPPTEQDLTK
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(STAT6 monoclonal antibody, Western Blot analysis of STAT6 expression in HeLa.)

Western Blot (WB) (STAT6 monoclonal antibody, Western Blot analysis of STAT6 expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of STAT6 expression in transfected 293T cell line by STAT6 monoclonal antibody. Lane 1: STAT6 transfected lysate (94.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of STAT6 expression in transfected 293T cell line by STAT6 monoclonal antibody. Lane 1: STAT6 transfected lysate (94.1kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to STAT6 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to STAT6 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to STAT6 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to STAT6 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged STAT6 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged STAT6 is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-STAT6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
81,748 Da
NCBI Official Full Name
signal transducer and activator of transcription 6 isoform 1
NCBI Official Synonym Full Names
signal transducer and activator of transcription 6, interleukin-4 induced
NCBI Official Symbol
STAT6
NCBI Official Synonym Symbols
STAT6B; STAT6C; D12S1644; IL-4-STAT
NCBI Protein Information
signal transducer and activator of transcription 6

NCBI Description

The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein plays a central role in exerting IL4 mediated biological responses. It is found to induce the expression of BCL2L1/BCL-X(L), which is responsible for the anti-apoptotic activity of IL4. Knockout studies in mice suggested the roles of this gene in differentiation of T helper 2 (Th2) cells, expression of cell surface markers, and class switch of immunoglobulins. Alternative splicing results in multiple transcript variants.[provided by RefSeq, May 2010]

Research Articles on STAT6

Similar Products

Product Notes

The STAT6 (Catalog #AAA6134020) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The STAT6 (Signal Transducer and Activator of Transcription 6, IL-4 Stat) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's STAT6 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the STAT6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "STAT6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.