Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human SNF8 Monoclonal Antibody | anti-SNF8 antibody

SNF8 (EAP30, Vacuolar-sorting Protein SNF8, ELL-associated Protein of 30kD, ESCRT-II Complex Subunit VPS22) (AP)

Gene Names
SNF8; Dot3; EAP30; VPS22
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SNF8; Monoclonal Antibody; SNF8 (EAP30; Vacuolar-sorting Protein SNF8; ELL-associated Protein of 30kD; ESCRT-II Complex Subunit VPS22) (AP); anti-SNF8 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
6B11
Specificity
Recognizes human EAP30.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-SNF8 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa23-123 from EAP30 (NP_009172) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEIRKNPEFRVQFQDMCATIGVDPLASGKGFWSEMLGVGDFYYELGVQIIEVCLALKHRNGGLITLE*
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Testing Data

(Detection limit for recombinant GST tagged SNF8 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SNF8 is ~1ng/ml as a capture antibody.)
Related Product Information for anti-SNF8 antibody
SNF8, VPS25 (MIM 610907), and VPS36 (MIM 610903) form ESCRT-II (endosomal sorting complex required for transport II), a complex involved in endocytosis of ubiquitinated membrane proteins. SNF8, VPS25, and VPS36 are also associated in a multiprotein complex with RNA polymerase II elongation factor (ELL; MIM 600284) (Slagsvold et al., 2005 [PubMed 15755741]; Kamura et al., 2001 [PubMed 11278625]).
Product Categories/Family for anti-SNF8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31.4kDa (282aa) confirmed by MALDI-TOF
NCBI Official Full Name
vacuolar-sorting protein SNF8 isoform 1
NCBI Official Synonym Full Names
SNF8, ESCRT-II complex subunit
NCBI Official Symbol
SNF8
NCBI Official Synonym Symbols
Dot3; EAP30; VPS22
NCBI Protein Information
vacuolar-sorting protein SNF8
UniProt Protein Name
Vacuolar-sorting protein SNF8
Protein Family
UniProt Gene Name
SNF8
UniProt Synonym Gene Names
EAP30; hVps22
UniProt Entry Name
SNF8_HUMAN

NCBI Description

The protein encoded by this gene is a component of the endosomal sorting complex required for transport II (ESCRT-II), which regulates the movement of ubiquitinylated transmembrane proteins to the lysosome for degradation. This complex also interacts with the RNA polymerase II elongation factor (ELL) to overcome the repressive effects of ELL on RNA polymerase II activity. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015]

Uniprot Description

SNF8: Component of the endosomal sorting complex required for transport II (ESCRT-II), which is required for multivesicular body (MVB) formation and sorting of endosomal cargo proteins into MVBs. The MVB pathway mediates delivery of transmembrane proteins into the lumen of the lysosome for degradation. The ESCRT-II complex is probably involved in the recruitment of the ESCRT-III complex. The ESCRT-II complex may also play a role in transcription regulation by participating in derepression of transcription by RNA polymerase II, possibly via its interaction with ELL. Required for degradation of both endocytosed EGF and EGFR, but not for the EGFR ligand-mediated internalization. It is also required for the degradation of CXCR4. Belongs to the SNF8 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor

Chromosomal Location of Human Ortholog: 17q21.32

Cellular Component: nucleoplasm; transcription factor complex; late endosome membrane; cytoplasm; cytosol

Molecular Function: protein binding; protein homodimerization activity; transcription factor binding

Biological Process: regulation of transcription from RNA polymerase II promoter; transcription, DNA-dependent; protein targeting to vacuole during ubiquitin-dependent protein catabolic process via the MVB pathway; endosome transport

Research Articles on SNF8

Similar Products

Product Notes

The SNF8 snf8 (Catalog #AAA6133894) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SNF8 (EAP30, Vacuolar-sorting Protein SNF8, ELL-associated Protein of 30kD, ESCRT-II Complex Subunit VPS22) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SNF8 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SNF8 snf8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SNF8, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.