Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human RSF1 Monoclonal Antibody | anti-RSF1 antibody

RSF1 (Remodeling and Spacing Factor 1, Rsf-1, HBV pX-associated Protein 8, Hepatitis B Virus X-associated Protein, p325 Subunit of RSF Chromatin-remodeling Complex, HBXAP, XAP8) (AP)

Gene Names
RSF1; XAP8; p325; HBXAP; RSF-1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RSF1; Monoclonal Antibody; RSF1 (Remodeling and Spacing Factor 1; Rsf-1; HBV pX-associated Protein 8; Hepatitis B Virus X-associated Protein; p325 Subunit of RSF Chromatin-remodeling Complex; HBXAP; XAP8) (AP); anti-RSF1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3E6
Specificity
Recognizes human HBXAP.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-RSF1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1343-1442 from human HBXAP (NP_057662) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
IESDEEEDFENVGKVGSPLDYSLVDLPSTNGQSPGKAIENLIGKPTEKSQTPKDNSTASASLASNGTSGGQEAGAPEEEEDELLRVTDLVDYVCNSEQL
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RSF1 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to RSF1 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged HBXAP is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HBXAP is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-RSF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
164kDa
NCBI Official Full Name
remodeling and spacing factor 1
NCBI Official Synonym Full Names
remodeling and spacing factor 1
NCBI Official Symbol
RSF1
NCBI Official Synonym Symbols
XAP8; p325; HBXAP; RSF-1
NCBI Protein Information
remodeling and spacing factor 1
UniProt Protein Name
Remodeling and spacing factor 1
Protein Family
UniProt Gene Name
RSF1
UniProt Synonym Gene Names
HBXAP; XAP8; Rsf-1
UniProt Entry Name
RSF1_HUMAN

NCBI Description

This gene encodes a nuclear protein that interacts with hepatitis B virus X protein (HBX) and facilitates transcription of hepatitis B virus genes by the HBX transcription activator, suggesting a role for this interaction in the virus life cycle. This protein also interacts with SNF2H protein to form the RSF chromatin-remodeling complex, where the SNF2H subunit functions as the nucleosome-dependent ATPase, and this protein as the histone chaperone. [provided by RefSeq, Sep 2011]

Uniprot Description

HBXAP: Required for assembly of regular nucleosome arrays by the RSF chromatin-remodeling complex. Facilitates transcription of hepatitis B virus (HBV) genes by the pX transcription activator. In case of infection by HBV, together with pX, it represses TNF- alpha induced NF-kappa-B transcription activation. Represses transcription when artificially recruited to chromatin by fusion to a heterogeneous DNA binding domain. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 11q14.1

Cellular Component: nucleoplasm; RSF complex; nucleus

Molecular Function: protein binding; histone binding; zinc ion binding; ATPase activity

Biological Process: chromatin remodeling; nucleosome assembly; DNA replication-independent nucleosome assembly at centromere; positive regulation of viral transcription; positive regulation of transcription, DNA-dependent; transcription initiation; negative regulation of transcription, DNA-dependent; negative regulation of DNA binding; nucleosome positioning

Research Articles on RSF1

Similar Products

Product Notes

The RSF1 rsf1 (Catalog #AAA6133558) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RSF1 (Remodeling and Spacing Factor 1, Rsf-1, HBV pX-associated Protein 8, Hepatitis B Virus X-associated Protein, p325 Subunit of RSF Chromatin-remodeling Complex, HBXAP, XAP8) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RSF1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RSF1 rsf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RSF1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.