Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.88kD).)

Mouse anti-Human RAB8B Monoclonal Antibody | anti-RAB8B antibody

RAB8B (Ras-related Protein Rab-8B) (AP)

Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RAB8B; Monoclonal Antibody; RAB8B (Ras-related Protein Rab-8B) (AP); FLJ38125; anti-RAB8B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1E4
Specificity
Recognizes human RAB8B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-RAB8B antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa101-208 from human RAB8B (NP_057614) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKSSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTSFFRCSLL
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.88kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.88kD).)

Testing Data

(Detection limit for recombinant GST tagged RAB8B is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RAB8B is 0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-RAB8B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25.7kDa (227aa)
NCBI Official Full Name
ras-related protein Rab-8B
NCBI Official Synonym Full Names
RAB8B, member RAS oncogene family
NCBI Official Symbol
RAB8B
NCBI Protein Information
ras-related protein Rab-8B
UniProt Protein Name
Ras-related protein Rab-8B
Protein Family
UniProt Gene Name
RAB8B
UniProt Entry Name
RAB8B_HUMAN

NCBI Description

RAB proteins, like RAB8B, are low molecular mass monomeric GTPases that localize on the cytoplasmic surfaces of distinct membrane-bound organelles. RAB proteins function in intracellular vesicle transport by aiding in the docking and/or fusion of vesicles with their target membranes (summary by Chen et al., 1997 [PubMed 9030196]).[supplied by OMIM, Nov 2010]

Uniprot Description

RAB8B: May be involved in vesicular trafficking and neurotransmitter release. May participate in cell junction dynamics in Sertoli cells. Belongs to the small GTPase superfamily. Rab family.

Protein type: G protein; Motility/polarity/chemotaxis; G protein, monomeric; G protein, monomeric, Rab

Chromosomal Location of Human Ortholog: 15q22.2

Cellular Component: peroxisomal membrane; phagocytic vesicle membrane; trans-Golgi network transport vesicle; synaptic vesicle; mitochondrion; perinuclear region of cytoplasm; secretory granule membrane; plasma membrane; phagocytic vesicle; endosome

Molecular Function: GTPase activity; protein binding; GDP binding; GTP binding; TPR domain binding; receptor binding

Biological Process: regulation of exocytosis; antigen processing and presentation; synaptic vesicle exocytosis; Golgi vesicle fusion to target membrane; cellular response to insulin stimulus; metabolic process; positive regulation of cell projection organization and biogenesis; protein secretion; cilium biogenesis; protein import into peroxisome membrane; Rab protein signal transduction; vesicle docking during exocytosis; positive regulation of adrenocorticotropic hormone secretion

Research Articles on RAB8B

Similar Products

Product Notes

The RAB8B rab8b (Catalog #AAA6133276) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RAB8B (Ras-related Protein Rab-8B) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RAB8B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RAB8B rab8b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RAB8B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.