Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged PDE10A is ~0.03ng/ml as a capture antibody.)

Mouse anti-Human PDE10A Monoclonal Antibody | anti-PDE10A antibody

PDE10A (cAMP and cAMP-inhibited cGMP 3',5'-cyclic Phosphodiesterase 10A, FLJ11894, FLJ25677, HSPDE10A) (AP)

Gene Names
PDE10A; HSPDE10A
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PDE10A; Monoclonal Antibody; PDE10A (cAMP and cAMP-inhibited cGMP 3'; 5'-cyclic Phosphodiesterase 10A; FLJ11894; FLJ25677; HSPDE10A) (AP); anti-PDE10A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4E1
Specificity
Recognizes human PDE10A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-PDE10A antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa242-333 from human PDE10A (NP_006652) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQVDHKNKELYSDLFDIGEEKEGKPVFKKTKEIRFSIEKGIAGQ
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged PDE10A is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PDE10A is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-PDE10A antibody
Plays a role in signal transduction by regulating the intracellular concentration of cyclic nucleotides. Can hydrolyze both cAMP and cGMP, but has higher affinity for cAMP and is more efficient with cAMP as substrate.
Product Categories/Family for anti-PDE10A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
89,390 Da
NCBI Official Full Name
cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A isoform 2
NCBI Official Synonym Full Names
phosphodiesterase 10A
NCBI Official Symbol
PDE10A
NCBI Official Synonym Symbols
HSPDE10A
NCBI Protein Information
cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
UniProt Protein Name
cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
UniProt Gene Name
PDE10A
UniProt Entry Name
PDE10_HUMAN

NCBI Description

The protein encoded by this gene belongs to the cyclic nucleotide phosphodiesterase family. It plays a role in signal transduction by regulating the intracellular concentration of cyclic nucleotides. This protein can hydrolyze both cAMP and cGMP to the corresponding nucleoside 5' monophosphate, but has higher affinity for cAMP, and is more efficient with cAMP as substrate. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Dec 2011]

Uniprot Description

PDE10A: Plays a role in signal transduction by regulating the intracellular concentration of cyclic nucleotides. Can hydrolyze both cAMP and cGMP, but has higher affinity for cAMP and is more efficient with cAMP as substrate. Belongs to the cyclic nucleotide phosphodiesterase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.1.4.35; Nucleotide Metabolism - purine; EC 3.1.4.17; Phosphodiesterase

Chromosomal Location of Human Ortholog: 6q26

Cellular Component: cytosol

Molecular Function: 3',5'-cyclic-GMP phosphodiesterase activity; metal ion binding; cGMP-stimulated cyclic-nucleotide phosphodiesterase activity; cGMP binding; cAMP binding; 3',5'-cyclic-nucleotide phosphodiesterase activity

Biological Process: cAMP catabolic process; cGMP catabolic process; signal transduction; blood coagulation

Research Articles on PDE10A

Similar Products

Product Notes

The PDE10A pde10a (Catalog #AAA6132845) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PDE10A (cAMP and cAMP-inhibited cGMP 3',5'-cyclic Phosphodiesterase 10A, FLJ11894, FLJ25677, HSPDE10A) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PDE10A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PDE10A pde10a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PDE10A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.