Mouse anti-Human MAD2L1 Monoclonal Antibody | anti-MAD2L1 antibody

MAD2L1 (Mitotic Spindle Assembly Checkpoint Protein MAD2A, MAD2-like 1, HsMAD2) (AP)

Cat. Num. AAA6132173

• Gene Names: MAD2L1; MAD2; HSMAD2
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MAD2L1; Monoclonal Antibody; MAD2L1 (Mitotic Spindle Assembly Checkpoint Protein MAD2A; MAD2-like 1; HsMAD2) (AP); anti-MAD2L1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 2E2-1D6
• Specificity: Recognizes human MAD2L1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-MAD2L1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-205 from human MAD2L1 (AAH00356) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (48.29kD).)

Western Blot (WB)

(MAD2L1 monoclonal antibody Western Blot analysis of MAD2L1 expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of MAD2L1 expression in transfected 293T cell line by MAD2L1 monoclonal antibody. Lane 1: MAD2L1 transfected lysate (23.5kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged MAD2L1 is ~0.03ng/ml as a capture antibody.)

Related Product Information for anti-MAD2L1 antibody

MAD2L1 is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. MAD2L1 is related to the MAD2L2 gene located on chromosome 1. A MAD2 pseudogene has been mapped to chromosome 14.

Product Categories/Family for anti-MAD2L1 antibody

Antibodies; Cell Division Cycle (CDC)

References

1. RED, a spindle pole-associated protein, is required for kinetochore localization of MAD1, mitotic progression, and activation of the spindle assembly checkpoint. Yeh PC, Yeh CC, Chen YC, Juang YL.J Biol Chem. 2012 Apr 6;287(15):11704-16. Epub 2012 Feb 18.

NCBI and Uniprot Product Information

• NCBI GI #: 33875346
• NCBI GeneID: 4085
• Molecular Weight: 10,335 Da
• NCBI Official Full Name: Homo sapiens MAD2 mitotic arrest deficient-like 1 (yeast), mRNA
• NCBI Official Synonym Full Names: MAD2 mitotic arrest deficient-like 1 (yeast)
• NCBI Official Symbol: MAD2L1
• NCBI Official Synonym Symbols: MAD2; HSMAD2
• NCBI Protein Information: mitotic spindle assembly checkpoint protein MAD2A
• Protein Family: MAD2L1-binding protein

NCBI Description

MAD2L1 is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. MAD2L1 is related to the MAD2L2 gene located on chromosome 1. A MAD2 pseudogene has been mapped to chromosome 14. [provided by RefSeq, Jul 2008]