Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunoprecipitation (IP) (Immunoprecipitation of HYAL1 transfected lysate using HYAL1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HYAL1 rabbit polyclonal antibody.)

Mouse anti-Human Hyaluronoglucosaminidase 1 Monoclonal Antibody | anti-HYAL1 antibody

Hyaluronoglucosaminidase 1 (HYAL1, Hyaluronidase-1, Hyal-1, LuCa-1, LUCA1, Hyaluronoglucosaminidase-1, Lung Carcinoma Protein 1) (AP)

Gene Names
HYAL1; MPS9; NAT6; LUCA1; HYAL-1
Reactivity
Human
Applications
ELISA, Immunoprecipitation
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Hyaluronoglucosaminidase 1; Monoclonal Antibody; Hyaluronoglucosaminidase 1 (HYAL1; Hyaluronidase-1; Hyal-1; LuCa-1; LUCA1; Hyaluronoglucosaminidase-1; Lung Carcinoma Protein 1) (AP); anti-HYAL1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2H7
Specificity
Recognizes human HYAL1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-HYAL1 antibody
ELISA (EIA), Immunoprecipitation (IP)
Application Notes
Sandwich ELISA: The detection limit is ~1ng/ml as a capture antibody
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa60-159 from human HYAL1 (NP_009296) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ANPGQTFRGPDMTIFYSSQLGTYPYYTPTGEPVFGGLPQNASLIAHLARTFQDILAAIPAPDFSGLAVIDWEAWRPRWAFNWDTKDIYRQRSRALVQAQH
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunoprecipitation (IP)

(Immunoprecipitation of HYAL1 transfected lysate using HYAL1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HYAL1 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of HYAL1 transfected lysate using HYAL1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HYAL1 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged HYAL1 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HYAL1 is ~1ng/ml as a capture antibody.)
Product Categories/Family for anti-HYAL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
37,439 Da
NCBI Official Synonym Full Names
hyaluronidase 1
NCBI Official Symbol
HYAL1
NCBI Official Synonym Symbols
MPS9; NAT6; LUCA1; HYAL-1
NCBI Protein Information
hyaluronidase-1
UniProt Protein Name
Hyaluronidase-1
UniProt Gene Name
HYAL1
UniProt Synonym Gene Names
LUCA1; Hyal-1; LuCa-1
UniProt Entry Name
HYAL1_HUMAN

NCBI Description

This gene encodes a lysosomal hyaluronidase. Hyaluronidases intracellularly degrade hyaluronan, one of the major glycosaminoglycans of the extracellular matrix. Hyaluronan is thought to be involved in cell proliferation, migration and differentiation. This enzyme is active at an acidic pH and is the major hyaluronidase in plasma. Mutations in this gene are associated with mucopolysaccharidosis type IX, or hyaluronidase deficiency. The gene is one of several related genes in a region of chromosome 3p21.3 associated with tumor suppression. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

HYAL1: May have a role in promoting tumor progression. May block the TGFB1-enhanced cell growth. Defects in HYAL1 are the cause of mucopolysaccharidosis type 9 (MPS9); also called hyaluronidase deficiency. MPS9 is a lysosomal storage disease characterized by high hyaluronan (HA) concentration in the serum. The clinical features are periarticular soft tissue masses, mild short stature and acetabular erosions, and absence of neurological or visceral involvement. Belongs to the glycosyl hydrolase 56 family. 7 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.2.1.35; Glycan Metabolism - glycosaminoglycan degradation; Secreted, signal peptide; Secreted; Hydrolase

Chromosomal Location of Human Ortholog: 3p21.31

Cellular Component: extracellular space; lysosomal lumen; lysosome; cytoplasm; cytoplasmic vesicle

Molecular Function: viral receptor activity; hyaluronan synthase activity; transcription factor binding; hyalurononglucosaminidase activity

Biological Process: positive regulation of cell adhesion; glycosaminoglycan metabolic process; response to virus; pathogenesis; positive regulation of cell growth; hyaluronan catabolic process; response to antibiotic; chondroitin sulfate metabolic process; positive regulation of angiogenesis; response to reactive oxygen species; hyaluronan biosynthetic process; cartilage development; carbohydrate metabolic process; chondroitin sulfate catabolic process; negative regulation of cell growth; inflammatory response; hyaluronan metabolic process; positive regulation of growth; positive regulation of epithelial cell proliferation

Disease: Mucopolysaccharidosis, Type Ix

Research Articles on HYAL1

Similar Products

Product Notes

The HYAL1 hyal1 (Catalog #AAA6131786) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Hyaluronoglucosaminidase 1 (HYAL1, Hyaluronidase-1, Hyal-1, LuCa-1, LUCA1, Hyaluronoglucosaminidase-1, Lung Carcinoma Protein 1) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Hyaluronoglucosaminidase 1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP). Sandwich ELISA: The detection limit is ~1ng/ml as a capture antibody Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HYAL1 hyal1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Hyaluronoglucosaminidase 1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.