Mouse anti-Human Hyaluronoglucosaminidase 1 Monoclonal Antibody | anti-HYAL1 antibody

Hyaluronoglucosaminidase 1 (HYAL1, Hyaluronidase-1, Hyal-1, LuCa-1, LUCA1, Hyaluronoglucosaminidase-1, Lung Carcinoma Protein 1) APC

Cat. Num. AAA6137089

• Gene Names: HYAL1; MPS9; NAT6; LUCA1; HYAL-1
• Reactivity: Human
• Applications: ELISA, Immunoprecipitation
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Hyaluronoglucosaminidase 1; Monoclonal Antibody; Hyaluronoglucosaminidase 1 (HYAL1; Hyaluronidase-1; Hyal-1; LuCa-1; LUCA1; Hyaluronoglucosaminidase-1; Lung Carcinoma Protein 1) APC; anti-HYAL1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2H7
• Specificity: Recognizes human HYAL1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-HYAL1 antibody: ELISA (EIA), Immunoprecipitation (IP)
• Application Notes: Sandwich ELISA: The detection limit is ~1ng/ml as a capture antibody; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa60-159 from human HYAL1 (NP_009296) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ANPGQTFRGPDMTIFYSSQLGTYPYYTPTGEPVFGGLPQNASLIAHLARTFQDILAAIPAPDFSGLAVIDWEAWRPRWAFNWDTKDIYRQRSRALVQAQH
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunoprecipitation (IP)

(Immunoprecipitation of HYAL1 transfected lysate using HYAL1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HYAL1 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged HYAL1 is ~1ng/ml as a capture antibody.)

Product Categories/Family for anti-HYAL1 antibody

Antibodies; Enzymes; Glycosidase

NCBI and Uniprot Product Information

• NCBI GI #: 6224976
• NCBI GeneID: 3373
• NCBI Accession #: NP_009296
• NCBI GenBank Nucleotide #: NM_007312
• UniProt Accession #: Q12794; Q6FH23; Q6PIZ6; Q7KYU2; Q7LE34; Q8NFK5; Q8NFK6; Q8NFK7; Q8NFK8; Q8NFK9; Q93013; Q9UKD5
• Molecular Weight: 37,439 Da
• NCBI Official Synonym Full Names: hyaluronidase 1
• NCBI Official Symbol: HYAL1
• NCBI Official Synonym Symbols: MPS9; NAT6; LUCA1; HYAL-1
• NCBI Protein Information: hyaluronidase-1
• UniProt Protein Name: Hyaluronidase-1
• UniProt Gene Name: HYAL1
• UniProt Synonym Gene Names: LUCA1; Hyal-1; LuCa-1
• UniProt Entry Name: HYAL1_HUMAN

NCBI Description

This gene encodes a lysosomal hyaluronidase. Hyaluronidases intracellularly degrade hyaluronan, one of the major glycosaminoglycans of the extracellular matrix. Hyaluronan is thought to be involved in cell proliferation, migration and differentiation. This enzyme is active at an acidic pH and is the major hyaluronidase in plasma. Mutations in this gene are associated with mucopolysaccharidosis type IX, or hyaluronidase deficiency. The gene is one of several related genes in a region of chromosome 3p21.3 associated with tumor suppression. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

HYAL1: May have a role in promoting tumor progression. May block the TGFB1-enhanced cell growth. Defects in HYAL1 are the cause of mucopolysaccharidosis type 9 (MPS9); also called hyaluronidase deficiency. MPS9 is a lysosomal storage disease characterized by high hyaluronan (HA) concentration in the serum. The clinical features are periarticular soft tissue masses, mild short stature and acetabular erosions, and absence of neurological or visceral involvement. Belongs to the glycosyl hydrolase 56 family. 7 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.2.1.35; Glycan Metabolism - glycosaminoglycan degradation; Secreted, signal peptide; Secreted; Hydrolase

Chromosomal Location of Human Ortholog: 3p21.31

Cellular Component: extracellular space; lysosomal lumen; lysosome; cytoplasm; cytoplasmic vesicle

Molecular Function: viral receptor activity; hyaluronan synthase activity; transcription factor binding; hyalurononglucosaminidase activity

Biological Process: positive regulation of cell adhesion; glycosaminoglycan metabolic process; response to virus; pathogenesis; positive regulation of cell growth; hyaluronan catabolic process; response to antibiotic; chondroitin sulfate metabolic process; positive regulation of angiogenesis; response to reactive oxygen species; hyaluronan biosynthetic process; cartilage development; carbohydrate metabolic process; chondroitin sulfate catabolic process; negative regulation of cell growth; inflammatory response; hyaluronan metabolic process; positive regulation of growth; positive regulation of epithelial cell proliferation

Disease: Mucopolysaccharidosis, Type Ix