Mouse anti-Human GNB3 Monoclonal Antibody | anti-GNB3 antibody

GNB3 (Guanine Nucleotide Binding Protein (G-Protein) beta Polypeptide 3, Guanine Nucleotide-binding Protein G(I)/G(S)/G(T) beta Subunit 3, Transducin beta Chain 3) (AP)

Cat. Num. AAA6131510

• Gene Names: GNB3; CSNB1H
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: GNB3; Monoclonal Antibody; GNB3 (Guanine Nucleotide Binding Protein (G-Protein) beta Polypeptide 3; Guanine Nucleotide-binding Protein G(I)/G(S)/G(T) beta Subunit 3; Transducin beta Chain 3) (AP); anti-GNB3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: M1-1-1D5
• Specificity: Recognizes human GNB3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 1715

• Applicable Applications for anti-GNB3 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-340 from human GNB3 (AAH02454) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MGEMEQLRQEAEQLKKQIADARKACAGVTLAELVSGLEVVGRVQMRTRRTLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNMCSIYNLKSREGNVKVSRELSAHTGYLSCCRFLDDNNIVTSSGDTTCALWDIETGQQKTVFVGHTGDCMSLAVSPDFNLFISGACDASAKLWDVREGTCRQTFTGHESDINAICFFPNGEAICTGSDDASCRLFDLRADQELICFSHESIICSITSVAFSLSGRLLFAGYDDFNCNVWDSMKSERVGILSGHDNRVSCLGVTADGMAVATGSWDSFLKIWN
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(GNB3 monoclonal antibody, Western Blot analysis of GNB3 expression in HepG2.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to GNB3 on HepG2 cell. [antibody concentration 10ug/ml].)

Product Categories/Family for anti-GNB3 antibody

Antibodies; G Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 33876705
• NCBI GeneID: 2784
• NCBI Official Full Name: Homo sapiens guanine nucleotide binding protein (G protein), beta polypeptide 3, mRNA
• NCBI Official Synonym Full Names: G protein subunit beta 3
• NCBI Official Symbol: GNB3
• NCBI Official Synonym Symbols: CSNB1H
• NCBI Protein Information: guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3

NCBI Description

Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. This gene encodes a beta subunit which belongs to the WD repeat G protein beta family. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors. A single-nucleotide polymorphism (C825T) in this gene is associated with essential hypertension and obesity. This polymorphism is also associated with the occurrence of the splice variant GNB3-s, which appears to have increased activity. GNB3-s is an example of alternative splicing caused by a nucleotide change outside of the splice donor and acceptor sites. Alternative splicing results in multiple transcript variants. Additional alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. [provided by RefSeq, Jul 2014]