Mouse anti-Human FBXO6 Monoclonal Antibody | anti-FBXO6 antibody

FBXO6 (F-box Only Protein 6, F-Box/G-domain Protein 2, F-box Protein That Recognizes Sugar Chains 2, FBG 2, FBG2, FBX 6, FBX6) (AP)

Cat. Num. AAA6131266

• Gene Names: FBXO6; FBG2; FBS2; FBX6; Fbx6b
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: FBXO6; Monoclonal Antibody; FBXO6 (F-box Only Protein 6; F-Box/G-domain Protein 2; F-box Protein That Recognizes Sugar Chains 2; FBG 2; FBG2; FBX 6; FBX6) (AP); anti-FBXO6 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3F10
• Specificity: Recognizes human FBXO6.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-FBXO6 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-294 from human FBXO6 (AAH20880) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MDAPHSKAALDSINELPENILLELFTHVPARQLLLNCRLVCSLWRDLIDLMTLWKRKCLREGFITKDWDQPVADWKIFYFLRSLHRNLLRNPCAEEDMFAWQIDFNGGDRWKVESLPGAHGTDFPDPKVKKYFVTSYEMCLKSQLVDLVAEGYWEELLDTFRPDIVVKDWFAARADCGCTYQLKVQLASADYFVLASFEPPPVTIQQWNNATWTEVSYTFSDYPRGVRYILFQHGGRDTQYWAGWYGPRVTNSSIVVSPKMTRNQASSEAQPGQKHGQEEAAQSPYRAVVQIF
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (58.34kD).)

Western Blot (WB)

(Western Blot analysis of FBXO6 expression in transfected 293T cell line by FBXO6 monoclonal antibody. Lane 1: FBXO6 transfected lysate (33.933kD). Lane 2: Non-transfected lysate)

Immunoprecipitation (IP)

(Immunoprecipitation of FBXO6 transfected lysate using FBXO6 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with FBXO6 monoclonal antibody.)

Related Product Information for anti-FBXO6 antibody

Substrate-recognition component of some SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complexes. Involved in endoplasmic reticulum-associated degradation pathway (ERAD) for misfolded lumenal proteins by recognizing and binding sugar chains on unfolded glycoproteins that are retrotranlocated into the cytosol and promoting their ubiquitination and subsequent degradation. Able to recognize and bind denatured glycoproteins, which are modified with not only high-mannose but also complex-type oligosaccharides. Also recognizes sulfated glycans. Also involved in DNA damage response by specifically recognizing activated CHEK1 (phosphorylated on 'Ser-345'), promoting its ubiquitination and degradation. Ubiquitination of CHEK1 is required to insure that activated CHEK1 does not accumulate as cells progress through S phase, or when replication forks encounter transient impediments during normal DNA replication.

Product Categories/Family for anti-FBXO6 antibody

Antibodies; Ubiquitin Ligases

NCBI and Uniprot Product Information

• NCBI GI #: 18088628
• NCBI GeneID: 26270
• Molecular Weight: 33,933 Da
• NCBI Official Full Name: Homo sapiens F-box protein 6, mRNA
• NCBI Official Synonym Full Names: F-box protein 6
• NCBI Official Symbol: FBXO6
• NCBI Official Synonym Symbols: FBG2; FBS2; FBX6; Fbx6b
• NCBI Protein Information: F-box only protein 6

NCBI Description

This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class, and its C-terminal region is highly similar to that of rat NFB42 (neural F Box 42 kDa) which may be involved in the control of the cell cycle. [provided by RefSeq, Jul 2008]