Western Blot (WB)
(Western Blot detection against Immunogen (37kD).)
Mouse anti-Human FBXL13 Monoclonal Antibody | anti-FBXL13 antibody
FBXL13 (FBL13, F-box/LRR-repeat Protein 13, F-box and Leucine-rich Repeat Protein 13, FLJ38068, MGC21636) (AP)
Gene Names
FBXL13; DRC6; Fbl13; CFAP169
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FBXL13; Monoclonal Antibody; FBXL13 (FBL13; F-box/LRR-repeat Protein 13; F-box and Leucine-rich Repeat Protein 13; FLJ38068; MGC21636) (AP); anti-FBXL13 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F7
Specificity
Recognizes human FBXL13.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
735
Applicable Applications for anti-FBXL13 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa636-735 from human FBXL13 (NP_659469) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ILDISGCVLLTDQILEDLQIGCKQLRILKMQYCTNISKKAAQRMSSKVQQQEYNTNDPPRWFGYDREGNPVTELDNITSSKGALELTVKKSTYSSEDQA
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (37kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (37kD).)
Related Product Information for anti-FBXL13 antibody
Members of the F-box protein family, such as FBXL13, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]). [supplied by OMIM].
Product Categories/Family for anti-FBXL13 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
dynein regulatory complex subunit 6 isoform 1
NCBI Official Synonym Full Names
F-box and leucine rich repeat protein 13
NCBI Official Symbol
FBXL13
NCBI Official Synonym Symbols
DRC6; Fbl13; CFAP169
NCBI Protein Information
dynein regulatory complex subunit 6
UniProt Protein Name
F-box/LRR-repeat protein 13
UniProt Gene Name
FBXL13
UniProt Synonym Gene Names
FBL13
UniProt Entry Name
FXL13_HUMAN
NCBI Description
Members of the F-box protein family, such as FBXL13, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM, Mar 2008]
Uniprot Description
Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.
Research Articles on FBXL13
Similar Products
Product Notes
The FBXL13 fbxl13 (Catalog #AAA6131246) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FBXL13 (FBL13, F-box/LRR-repeat Protein 13, F-box and Leucine-rich Repeat Protein 13, FLJ38068, MGC21636) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FBXL13 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FBXL13 fbxl13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FBXL13, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
