Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Mouse anti-Human, Mouse EphB2 Monoclonal Antibody | anti-EphB2 antibody

EphB2 (Ephrin Type-B Receptor 2, DRT, EPH-like Kinase 5, EK5, hEK5, ERK, Renal Carcinoma Antigen NY-REN-47, Tyrosine-protein Kinase TYRO5, Tyrosine-protein Kinase Receptor EPH-3, DRT, EPHT3, EPTH3, ERK, HEK5, TYRO5) (AP)

Gene Names
EPHB2; DRT; EK5; ERK; CAPB; Hek5; PCBC; EPHT3; Tyro5
Reactivity
Human, Mouse
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
EphB2; Monoclonal Antibody; EphB2 (Ephrin Type-B Receptor 2; DRT; EPH-like Kinase 5; EK5; hEK5; ERK; Renal Carcinoma Antigen NY-REN-47; Tyrosine-protein Kinase TYRO5; Tyrosine-protein Kinase Receptor EPH-3; EPHT3; EPTH3; HEK5; TYRO5) (AP); anti-EphB2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4D1
Specificity
Recognizes human EPHB2. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-EphB2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa226-325 from human EPHB2 (NP_059145) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
CIANAEEVDVPIKLYCNGDGEWLVPIGRCMCKAGFEAVENGTVCRGCPSGTFKANQGDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLDMPCTTIP
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(EPHB2 monoclonal antibody, Western Blot analysis of EPHB2 expression in NIH/3T3.)

Western Blot (WB) (EPHB2 monoclonal antibody, Western Blot analysis of EPHB2 expression in NIH/3T3.)

Testing Data

(Detection limit for recombinant GST tagged EPHB2 is 3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged EPHB2 is 3ng/ml as a capture antibody.)
Related Product Information for anti-EphB2 antibody
Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. The ligand-activated form of EphB2, which belongs to the Tyr family of protein kinases, interacts with multiple proteins, including GTPase-activating protein (RASGAP) through its SH2 domain. It binds RASGAP through the juxtamembrane tyrosines residues, and also interacts with PRKCABP and GRIP1 This type I membrane protein is expressed in brain, heart, lung, kidney, placenta, pancreas, liver and skeletal muscle. It is preferentially expressed in fetal brain. This protein contains putatively 2 fibronectin type III domains and 1 sterile alpha motif (SAM) domain.
Product Categories/Family for anti-EphB2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59.1kDa (533aa) 50-70KDa (SDS-PAGE under reducing conditions.)
NCBI Official Full Name
ephrin type-B receptor 2 isoform 1
NCBI Official Synonym Full Names
EPH receptor B2
NCBI Official Symbol
EPHB2
NCBI Official Synonym Symbols
DRT; EK5; ERK; CAPB; Hek5; PCBC; EPHT3; Tyro5
NCBI Protein Information
ephrin type-B receptor 2
UniProt Protein Name
Ephrin type-B receptor 2
Protein Family
UniProt Gene Name
EPHB2
UniProt Synonym Gene Names
DRT; EPHT3; EPTH3; ERK; HEK5; TYRO5; EK5; hEK5
UniProt Entry Name
EPHB2_HUMAN

NCBI Description

This gene encodes a member of the Eph receptor family of receptor tyrosine kinase transmembrane glycoproteins. These receptors are composed of an N-terminal glycosylated ligand-binding domain, a transmembrane region and an intracellular kinase domain. They bind ligands called ephrins and are involved in diverse cellular processes including motility, division, and differentiation. A distinguishing characteristic of Eph-ephrin signaling is that both receptors and ligands are competent to transduce a signaling cascade, resulting in bidirectional signaling. This protein belongs to a subgroup of the Eph receptors called EphB. Proteins of this subgroup are distinguished from other members of the family by sequence homology and preferential binding affinity for membrane-bound ephrin-B ligands. Allelic variants are associated with prostate and brain cancer susceptibility. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2015]

Uniprot Description

EphB2: a receptor tyrosine kinase of the Eph family. A receptor for ephrin-B family members. Activated EphB2 recruits RasGAP, down-regulating the Ras-Erk signaling axis and neurite retraction. The Eph receptor tyrosine kinase family, the largest in the tyrosine kinase group, has fourteen members. They bind membrane-anchored ligands, ephrins, at sites of cell-cell contact, regulating the repulsion and adhesion of cells that underlie the establishment, maintenance, and remodeling of patterns of cellular organization. Eph signals are particularly important in regulating cell adhesion and cell migration during development, axon guidance, homeostasis and disease. EphA receptors bind to GPI-anchored ephrin-A ligands, while EphB receptors bind to ephrin-B proteins that have a transmembrane and cytoplasmic domain. Interactions between EphB receptor kinases and ephrin-B proteins transduce signals bidirectionally, signaling to both interacting cell types. Eph receptors and ephrins also regulate the adhesion of endothelial cells and are required for the remodeling of blood vessels. The ligand-activated form of EphB2 interacts with multiple proteins, including GTPase-activating protein (RASGAP) through its SH2 domain. Point mutations seen in prostate cancer. Overexpressed and required for migration of glioblastoma. Overexpressed and correlated with poor survival in breast cancer. Overexpression and loss of heterozygosity seen in colorectal cancers. Target for immunoconjugate drug therapy .Three splice-variant isoforms have been described.

Protein type: Protein kinase, TK; Kinase, protein; EC 2.7.10.1; Membrane protein, integral; Tumor suppressor; Protein kinase, tyrosine (receptor); TK group; Eph family

Chromosomal Location of Human Ortholog: 1p36.1-p35

Cellular Component: cell soma; integral to plasma membrane; axon; dendrite; extracellular region; plasma membrane; cytosol

Molecular Function: protein binding; transmembrane-ephrin receptor activity; protein-tyrosine kinase activity; axon guidance receptor activity; ATP binding; receptor binding

Biological Process: nervous system development; axon guidance; inner ear morphogenesis; peptidyl-tyrosine phosphorylation; axonal fasciculation; central nervous system projection neuron axonogenesis; learning; palate development; optic nerve morphogenesis; positive regulation of long-term neuronal synaptic plasticity; corpus callosum development; positive regulation of synaptogenesis; regulation of body fluid levels; camera-type eye morphogenesis; ephrin receptor signaling pathway; negative regulation of axonogenesis; angiogenesis; phosphorylation; urogenital system development; retinal ganglion cell axon guidance

Disease: Prostate Cancer/brain Cancer Susceptibility

Research Articles on EphB2

Similar Products

Product Notes

The EphB2 ephb2 (Catalog #AAA6131146) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The EphB2 (Ephrin Type-B Receptor 2, DRT, EPH-like Kinase 5, EK5, hEK5, ERK, Renal Carcinoma Antigen NY-REN-47, Tyrosine-protein Kinase TYRO5, Tyrosine-protein Kinase Receptor EPH-3, DRT, EPHT3, EPTH3, ERK, HEK5, TYRO5) (AP) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's EphB2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EphB2 ephb2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EphB2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.