Mouse anti-Human, Mouse EphB2 Monoclonal Antibody | anti-EphB2 antibody

EphB2 (Ephrin Type-B Receptor 2, DRT, EPH-like Kinase 5, EK5, hEK5, ERK, Renal Carcinoma Antigen NY-REN-47, Tyrosine-protein Kinase TYRO5, Tyrosine-protein Kinase Receptor EPH-3, DRT, EPHT3, EPTH3, ERK, HEK5, TYRO5) (FITC)

Cat. Num. AAA6147055

• Gene Names: EPHB2; DRT; EK5; ERK; CAPB; Hek5; PCBC; EPHT3; Tyro5
• Reactivity: Human, Mouse
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: EphB2; Monoclonal Antibody; EphB2 (Ephrin Type-B Receptor 2; DRT; EPH-like Kinase 5; EK5; hEK5; ERK; Renal Carcinoma Antigen NY-REN-47; Tyrosine-protein Kinase TYRO5; Tyrosine-protein Kinase Receptor EPH-3; EPHT3; EPTH3; HEK5; TYRO5) (FITC); anti-EphB2 antibody

• Host: Mouse
• Reactivity: Human, Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4D1
• Specificity: Recognizes human EPHB2. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-EphB2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa226-325 from human EPHB2 (NP_059145) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: CIANAEEVDVPIKLYCNGDGEWLVPIGRCMCKAGFEAVENGTVCRGCPSGTFKANQGDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLDMPCTTIP
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(EPHB2 monoclonal antibody, Western Blot analysis of EPHB2 expression in NIH/3T3.)

Testing Data

(Detection limit for recombinant GST tagged EPHB2 is 3ng/ml as a capture antibody.)

Related Product Information for anti-EphB2 antibody

Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. The ligand-activated form of EphB2, which belongs to the Tyr family of protein kinases, interacts with multiple proteins, including GTPase-activating protein (RASGAP) through its SH2 domain. It binds RASGAP through the juxtamembrane tyrosines residues, and also interacts with PRKCABP and GRIP1 This type I membrane protein is expressed in brain, heart, lung, kidney, placenta, pancreas, liver and skeletal muscle. It is preferentially expressed in fetal brain. This protein contains putatively 2 fibronectin type III domains and 1 sterile alpha motif (SAM) domain.

Product Categories/Family for anti-EphB2 antibody

Antibodies; Tyrosine Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 111118978
• NCBI GeneID: 2048
• NCBI Accession #: NP_059145
• NCBI GenBank Nucleotide #: NM_017449
• UniProt Accession #: P29323; O43477; Q5T0U6; Q5T0U7; Q5T0U8
• Molecular Weight: 59.1kDa (533aa) 50-70KDa (SDS-PAGE under reducing conditions.)
• NCBI Official Full Name: ephrin type-B receptor 2 isoform 1
• NCBI Official Synonym Full Names: EPH receptor B2
• NCBI Official Symbol: EPHB2
• NCBI Official Synonym Symbols: DRT; EK5; ERK; CAPB; Hek5; PCBC; EPHT3; Tyro5
• NCBI Protein Information: ephrin type-B receptor 2
• UniProt Protein Name: Ephrin type-B receptor 2
• Protein Family: Ephrin type-B receptor
• UniProt Gene Name: EPHB2
• UniProt Synonym Gene Names: DRT; EPHT3; EPTH3; ERK; HEK5; TYRO5; EK5; hEK5
• UniProt Entry Name: EPHB2_HUMAN

NCBI Description

This gene encodes a member of the Eph receptor family of receptor tyrosine kinase transmembrane glycoproteins. These receptors are composed of an N-terminal glycosylated ligand-binding domain, a transmembrane region and an intracellular kinase domain. They bind ligands called ephrins and are involved in diverse cellular processes including motility, division, and differentiation. A distinguishing characteristic of Eph-ephrin signaling is that both receptors and ligands are competent to transduce a signaling cascade, resulting in bidirectional signaling. This protein belongs to a subgroup of the Eph receptors called EphB. Proteins of this subgroup are distinguished from other members of the family by sequence homology and preferential binding affinity for membrane-bound ephrin-B ligands. Allelic variants are associated with prostate and brain cancer susceptibility. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2015]

Uniprot Description

EphB2: a receptor tyrosine kinase of the Eph family. A receptor for ephrin-B family members. Activated EphB2 recruits RasGAP, down-regulating the Ras-Erk signaling axis and neurite retraction. The Eph receptor tyrosine kinase family, the largest in the tyrosine kinase group, has fourteen members. They bind membrane-anchored ligands, ephrins, at sites of cell-cell contact, regulating the repulsion and adhesion of cells that underlie the establishment, maintenance, and remodeling of patterns of cellular organization. Eph signals are particularly important in regulating cell adhesion and cell migration during development, axon guidance, homeostasis and disease. EphA receptors bind to GPI-anchored ephrin-A ligands, while EphB receptors bind to ephrin-B proteins that have a transmembrane and cytoplasmic domain. Interactions between EphB receptor kinases and ephrin-B proteins transduce signals bidirectionally, signaling to both interacting cell types. Eph receptors and ephrins also regulate the adhesion of endothelial cells and are required for the remodeling of blood vessels. The ligand-activated form of EphB2 interacts with multiple proteins, including GTPase-activating protein (RASGAP) through its SH2 domain. Point mutations seen in prostate cancer. Overexpressed and required for migration of glioblastoma. Overexpressed and correlated with poor survival in breast cancer. Overexpression and loss of heterozygosity seen in colorectal cancers. Target for immunoconjugate drug therapy .Three splice-variant isoforms have been described.

Protein type: Protein kinase, TK; Kinase, protein; EC 2.7.10.1; Membrane protein, integral; Tumor suppressor; Protein kinase, tyrosine (receptor); TK group; Eph family

Chromosomal Location of Human Ortholog: 1p36.1-p35

Cellular Component: cell soma; integral to plasma membrane; axon; dendrite; extracellular region; plasma membrane; cytosol

Molecular Function: protein binding; transmembrane-ephrin receptor activity; protein-tyrosine kinase activity; axon guidance receptor activity; ATP binding; receptor binding

Biological Process: nervous system development; axon guidance; inner ear morphogenesis; peptidyl-tyrosine phosphorylation; axonal fasciculation; central nervous system projection neuron axonogenesis; learning; palate development; optic nerve morphogenesis; positive regulation of long-term neuronal synaptic plasticity; corpus callosum development; positive regulation of synaptogenesis; regulation of body fluid levels; camera-type eye morphogenesis; ephrin receptor signaling pathway; negative regulation of axonogenesis; angiogenesis; phosphorylation; urogenital system development; retinal ganglion cell axon guidance

Disease: Prostate Cancer/brain Cancer Susceptibility