Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human DGAT2 Monoclonal Antibody | anti-DGAT2 antibody

DGAT2 (Diacylglycerol O-acyltransferase 2, Acyl-CoA Retinol O-fatty-acyltransferase, ARAT, Retinol O-fatty-acyltransferase, Diglyceride Acyltransferase 2, HMFN1045, UNQ738/PRO1433, DKFZp686A15125) (AP)

Gene Names
DGAT2; ARAT; HMFN1045; GS1999FULL
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DGAT2; Monoclonal Antibody; DGAT2 (Diacylglycerol O-acyltransferase 2; Acyl-CoA Retinol O-fatty-acyltransferase; ARAT; Retinol O-fatty-acyltransferase; Diglyceride Acyltransferase 2; HMFN1045; UNQ738/PRO1433; DKFZp686A15125) (AP); anti-DGAT2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4C1
Specificity
Recognizes human DGAT2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-DGAT2 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa289-389 from human DGAT2 (NP_115953) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
IFEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPTQQDIDLYHTMYMEALVKLFDKHKTKFGLPETEVLEVN
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-DGAT2 antibody
Essential acyltransferase that catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates. Required for synthesis and storage of intracellular triglycerides. Probably plays a central role in cytosolic lipid accumulation. In liver, is primarily responsible for incorporating endogenously synthesized fatty acids into triglycerides. Functions also as an acyl-CoA retinol acyltransferase (ARAT).
Product Categories/Family for anti-DGAT2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,831 Da
NCBI Official Full Name
diacylglycerol O-acyltransferase 2 isoform 1
NCBI Official Synonym Full Names
diacylglycerol O-acyltransferase 2
NCBI Official Symbol
DGAT2
NCBI Official Synonym Symbols
ARAT; HMFN1045; GS1999FULL
NCBI Protein Information
diacylglycerol O-acyltransferase 2; diglyceride acyltransferase 2; retinol O-fatty-acyltransferase; acyl-CoA retinol O-fatty-acyltransferase; diacylglycerol O-acyltransferase homolog 2; diacylglycerol O-acyltransferase-like protein 2
UniProt Protein Name
Diacylglycerol O-acyltransferase 2
UniProt Gene Name
DGAT2
UniProt Synonym Gene Names
ARAT; Retinol O-fatty-acyltransferase
UniProt Entry Name
DGAT2_HUMAN

NCBI Description

This gene encodes one of two enzymes which catalyzes the final reaction in the synthesis of triglycerides in which diacylglycerol is covalently bound to long chain fatty acyl-CoAs. The encoded protein catalyzes this reaction at low concentrations of magnesium chloride while the other enzyme has high activity at high concentrations of magnesium chloride. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]

Uniprot Description

DGAT2: Essential acyltransferase that catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates. Required for synthesis and storage of intracellular triglycerides. Probably plays a central role in cytosolic lipid accumulation. In liver, is primarily responsible for incorporating endogenously synthesized fatty acids into triglycerides. Functions also as an acyl-CoA retinol acyltransferase (ARAT). Belongs to the diacylglycerol acyltransferase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Transferase; EC 2.3.1.76; Membrane protein, multi-pass; Lipid Metabolism - glycerolipid; Cofactor and Vitamin Metabolism - retinol; EC 2.3.1.20

Chromosomal Location of Human Ortholog: 11q13.5

Cellular Component: endoplasmic reticulum membrane; mitochondrion; perinuclear region of cytoplasm; endoplasmic reticulum; integral to membrane; integral to endoplasmic reticulum membrane; lipid particle

Molecular Function: 2-acylglycerol O-acyltransferase activity; protein homodimerization activity; retinol O-fatty-acyltransferase activity; diacylglycerol O-acyltransferase activity

Biological Process: sequestering of lipid; cholesterol homeostasis; retinol metabolic process; glycerol metabolic process; phospholipid metabolic process; fatty acid homeostasis; glycerophospholipid biosynthetic process; triacylglycerol biosynthetic process; diacylglycerol metabolic process; cellular lipid metabolic process

Research Articles on DGAT2

Similar Products

Product Notes

The DGAT2 dgat2 (Catalog #AAA6130919) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DGAT2 (Diacylglycerol O-acyltransferase 2, Acyl-CoA Retinol O-fatty-acyltransferase, ARAT, Retinol O-fatty-acyltransferase, Diglyceride Acyltransferase 2, HMFN1045, UNQ738/PRO1433, DKFZp686A15125) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DGAT2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DGAT2 dgat2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DGAT2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.