Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human CAPN9 Monoclonal Antibody | anti-CAPN9 antibody

CAPN9 (Calpain-9, Digestive Tract-specific Calpain, New Calpain 4, nCL-4, Protein CG36, NCL4) (AP)

Gene Names
CAPN9; GC36; nCL-4
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CAPN9; Monoclonal Antibody; CAPN9 (Calpain-9; Digestive Tract-specific Calpain; New Calpain 4; nCL-4; Protein CG36; NCL4) (AP); anti-CAPN9 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3A6
Specificity
Recognizes human CAPN9.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-CAPN9 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 1ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa591-690 from human CAPN9 (NP_006606) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DKLKQWINLFLRFDADKSGTMSTYELRTALKAAGFQLSSHLLQLIVLRYADEELQLDFDDFLNCLVRLENASRVFQALSTKNKEFIHLNINEFIHLTMNI
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(CAPN9 monoclonal antibody Western Blot analysis of CAPN9 expression in human colon.)

Western Blot (WB) (CAPN9 monoclonal antibody Western Blot analysis of CAPN9 expression in human colon.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CAPN9 on formalin-fixed paraffin-embedded human liver. [antibody concentration 1ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to CAPN9 on formalin-fixed paraffin-embedded human liver. [antibody concentration 1ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged CAPN9 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CAPN9 is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-CAPN9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
76,168 Da
NCBI Official Full Name
calpain-9 isoform 1
NCBI Official Synonym Full Names
calpain 9
NCBI Official Symbol
CAPN9
NCBI Official Synonym Symbols
GC36; nCL-4
NCBI Protein Information
calpain-9
UniProt Protein Name
Calpain-9
Protein Family
UniProt Gene Name
CAPN9
UniProt Synonym Gene Names
NCL4; nCL-4
UniProt Entry Name
CAN9_HUMAN

NCBI Description

Calpains are ubiquitous, well-conserved family of calcium-dependent, cysteine proteases. The calpain proteins are heterodimers consisting of an invariant small subunit and variable large subunits. The large subunit possesses a cysteine protease domain, and both subunits possess calcium-binding domains. Calpains have been implicated in neurodegenerative processes, as their activation can be triggered by calcium influx and oxidative stress. The protein encoded by this gene is expressed predominantly in stomach and small intestine and may have specialized functions in the digestive tract. This gene is thought to be associated with gastric cancer. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

CAPN9: Calcium-regulated non-lysosomal thiol-protease. Belongs to the peptidase C2 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.4.22.-; Protease; Calcium-binding

Chromosomal Location of Human Ortholog: 1q42.11-q42.3

Cellular Component: cytoplasm

Molecular Function: calcium-dependent cysteine-type endopeptidase activity; calcium ion binding

Biological Process: digestion; proteolysis

Research Articles on CAPN9

Similar Products

Product Notes

The CAPN9 capn9 (Catalog #AAA6130358) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CAPN9 (Calpain-9, Digestive Tract-specific Calpain, New Calpain 4, nCL-4, Protein CG36, NCL4) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CAPN9 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 1ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CAPN9 capn9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CAPN9, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.