Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human ALOX12 Monoclonal Antibody | anti-ALOX12 antibody

ALOX12 (Arachidonate 12-lipoxygenase, 12S-type, 12S-LOX, 12S-lipoxygenase, Platelet-type Lipoxygenase 12, LOG12) (AP)

Gene Names
ALOX12; LOG12; 12-LOX; 12S-LOX
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ALOX12; Monoclonal Antibody; ALOX12 (Arachidonate 12-lipoxygenase; 12S-type; 12S-LOX; 12S-lipoxygenase; Platelet-type Lipoxygenase 12; LOG12) (AP); anti-ALOX12 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2D10
Specificity
Recognizes human ALOX12.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-ALOX12 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa564-663 from human ALOX12 (NP_000688) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PPPTTKEDVTMATVMGSLPDVRQACLQMAISWHLSRRQPDMVPLGHHKEKYFSGPKPKAVLNQFRTDLEKLEKEITARNEQLDWPYEYLKPSCIENSVTI
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Testing Data

(Detection limit for recombinant GST tagged ALOX12 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ALOX12 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-ALOX12 antibody
Oxygenase and 14,15-leukotriene A4 synthase activity.
Product Categories/Family for anti-ALOX12 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
239
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
76kDa
NCBI Official Full Name
arachidonate 12-lipoxygenase, 12S-type
NCBI Official Synonym Full Names
arachidonate 12-lipoxygenase, 12S type
NCBI Official Symbol
ALOX12
NCBI Official Synonym Symbols
LOG12; 12-LOX; 12S-LOX
NCBI Protein Information
arachidonate 12-lipoxygenase, 12S-type
UniProt Protein Name
Arachidonate 12-lipoxygenase, 12S-type
UniProt Gene Name
ALOX12
UniProt Synonym Gene Names
LOG12; 12S-LOX
UniProt Entry Name
LOX12_HUMAN

NCBI Description

This gene encodes a member of the lipoxygenase family of proteins. The encoded enzyme acts on different polyunsaturated fatty acid substrates to generate bioactive lipid mediators including eicosanoids and lipoxins. The encoded enzyme and its reaction products have been shown to regulate platelet function. Elevated expression of this gene has been observed in pancreatic islets derived from human diabetes patients. Allelic variants in this gene may be associated with susceptibility to toxoplasmosis. Multiple pseudogenes of this gene have been identified in the human genome. [provided by RefSeq, Aug 2017]

Uniprot Description

ALOX12: Oxygenase and 14,15-leukotriene A4 synthase activity. Belongs to the lipoxygenase family.

Protein type: Lipid Metabolism - arachidonic acid; EC 1.13.11.31; Apoptosis; Oxidoreductase

Chromosomal Location of Human Ortholog: 17p13.1

Cellular Component: membrane; cytoplasm; cytosol; sarcolemma

Molecular Function: oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen; protein binding; hepoxilin A3 synthase activity; arachidonate 12-lipoxygenase activity; lipoxygenase activity; hepoxilin-epoxide hydrolase activity; iron ion binding

Biological Process: positive regulation of cell adhesion; positive regulation of smooth muscle cell proliferation; linoleic acid metabolic process; positive regulation of caspase activity; positive regulation of vasodilation; positive regulation of cell growth; positive regulation of angiogenesis; positive regulation of endothelial cell differentiation; positive regulation of mitochondrial depolarization; lipoxygenase pathway; positive regulation of cell proliferation; arachidonic acid metabolic process; fatty acid oxidation; hepoxilin biosynthetic process; cell motility; superoxide release; hepoxilin metabolic process; positive regulation of cell migration; aging; negative regulation of apoptosis

Research Articles on ALOX12

Similar Products

Product Notes

The ALOX12 alox12 (Catalog #AAA6129968) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ALOX12 (Arachidonate 12-lipoxygenase, 12S-type, 12S-LOX, 12S-lipoxygenase, Platelet-type Lipoxygenase 12, LOG12) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ALOX12 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ALOX12 alox12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ALOX12, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.