Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Formalin-fixed, paraffin-embedded human gastrointestinal stromal tumor (20X) stained with DOG1 MAb (DOG1.1).)

Mouse anti-Human DOG-1 Monoclonal Antibody | anti-DOG-1 antibody

DOG-1 (ANO1, Anoctamin 1, Calcium Activated Chloride Channel, Discovered On Gastrointestinal Stromal Tumors Protein 1,TAOS2, ORAOV2, TMEM16A) (HRP)

Gene Names
ANO1; DOG1; TAOS2; ORAOV2; TMEM16A
Reactivity
Human
Applications
Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Purified by Protein A/G Affinity Chromatography.
Synonyms
DOG-1; Monoclonal Antibody; DOG-1 (ANO1; Anoctamin 1; Calcium Activated Chloride Channel; Discovered On Gastrointestinal Stromal Tumors Protein 1; TAOS2; ORAOV2; TMEM16A) (HRP); ANO1; TMEM16A; anti-DOG-1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
DOG-1.1
Specificity
Recognizes human DOG-1 (ANO1).
Purity/Purification
Purified by Protein A/G Affinity Chromatography.
Form/Format
Supplied as a liquid in 10mM PBS. No preservative added. BSA-Free. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-DOG-1 antibody
Immunohistochemistry (IHC) Frozen/Paraffin, Immunoprecipitation (IP), Western Blot (WB)
Application Notes
WB: 0.5-1.0ug/ml
IHC-F/P: 0.5-1ug/ml for 30 minutes at RT
IP: 0.5-1ug/500ug protein lysate
Applications are based on unconjugated antibody.
Immunogen
A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHK-EKVLMVELFMREEQDKQQLLETCMEKER QKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a carrier protein. Cellular Localization: Cell Surface and Cytoplasmic
Conjugate
HRP
Positive Control
Gastrointestinal Stromal Tumor: GIST or testicular germ cell tumor. Melanocytes in the basal layer of the epidermis and mast cells in the dermis of normal skin.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunohistochemistry (IHC)

(Formalin-fixed, paraffin-embedded human gastrointestinal stromal tumor (20X) stained with DOG1 MAb (DOG1.1).)

Immunohistochemistry (IHC) (Formalin-fixed, paraffin-embedded human gastrointestinal stromal tumor (20X) stained with DOG1 MAb (DOG1.1).)
Product Categories/Family for anti-DOG-1 antibody
References
1. Espinosa I, et. al. Am J Surg Pathol 2008;32:210-218.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
74,369 Da
NCBI Official Full Name
anoctamin-1
NCBI Official Synonym Full Names
anoctamin 1, calcium activated chloride channel
NCBI Official Symbol
ANO1
NCBI Official Synonym Symbols
DOG1; TAOS2; ORAOV2; TMEM16A
NCBI Protein Information
anoctamin-1; Ca2+-activated Cl- channel; oral cancer overexpressed 2; tumor-amplified and overexpressed sequence 2; discovered on gastrointestinal stromal tumors protein 1; transmembrane protein 16A (eight membrane-spanning domains)
UniProt Protein Name
Anoctamin-1
UniProt Gene Name
ANO1
UniProt Synonym Gene Names
DOG1; ORAOV2; TAOS2; TMEM16A
UniProt Entry Name
ANO1_HUMAN

Uniprot Description

ANO1: Acts as a calcium-activated chloride channel. Required for normal tracheal development. Belongs to the anoctamin family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Transporter; Membrane protein, integral; Transporter, ion channel; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 11q13.3

Cellular Component: apical plasma membrane; cytoplasm; plasma membrane; external side of plasma membrane

Molecular Function: protein binding; protein homodimerization activity; intracellular calcium activated chloride channel activity; protein heterodimerization activity; calcium activated cation channel activity

Biological Process: regulation of membrane potential; multicellular organismal development; chloride transport; transmembrane transport; cation transport

Research Articles on DOG-1

Similar Products

Product Notes

The DOG-1 ano1 (Catalog #AAA6123091) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DOG-1 (ANO1, Anoctamin 1, Calcium Activated Chloride Channel, Discovered On Gastrointestinal Stromal Tumors Protein 1,TAOS2, ORAOV2, TMEM16A) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DOG-1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC) Frozen/Paraffin, Immunoprecipitation (IP), Western Blot (WB). WB: 0.5-1.0ug/ml IHC-F/P: 0.5-1ug/ml for 30 minutes at RT IP: 0.5-1ug/500ug protein lysate Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DOG-1 ano1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DOG-1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.