Mouse anti-Human ATP8B4 Monoclonal Antibody | anti-ATP8B4 antibody

ATP8B4 (Probable Phospholipid-transporting ATPase IM, ATPase Class I Type 8B Member 4, KIAA1939)

Cat. Num. AAA6013077

• Gene Names: ATP8B4; ATPIM
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: ATP8B4; Monoclonal Antibody; ATP8B4 (Probable Phospholipid-transporting ATPase IM; ATPase Class I Type 8B Member 4; KIAA1939); Anti -ATP8B4 (Probable Phospholipid-transporting ATPase IM; anti-ATP8B4 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4D5
• Specificity: Recognizes human ATP8B4.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: IMTFKRCSINGRIYGEVHDDLDQKTEITQEKEPVDFSVKSQADREFQFFDHHLMESIKMGDPKVHEFLRLLALCHTVMSEENSAGELI

• Applicable Applications for anti-ATP8B4 antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.
• Immunogen: Partial recombinant corresponding to aa401-489 from human ATP8B4 (NP_079113) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.79kD).)

Testing Data

(Detection limit for recombinant GST tagged ATP8B4 is 0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-ATP8B4 antibody

Antibodies; Abs to Enzymes; ATPase

NCBI and Uniprot Product Information

• NCBI GI #: 34980824
• NCBI GeneID: 79895
• UniProt Accession #: Q8TF62; Q9H727
• Molecular Weight: 135,868 Da
• NCBI Official Full Name: ATP8B4 protein
• NCBI Official Synonym Full Names: ATPase, class I, type 8B, member 4
• NCBI Official Symbol: ATP8B4
• NCBI Official Synonym Symbols: ATPIM
• NCBI Protein Information: probable phospholipid-transporting ATPase IM; potential phospholipid-transporting ATPase IM
• UniProt Protein Name: Probable phospholipid-transporting ATPase IM
• Protein Family: Probable phospholipid-transporting ATPase
• UniProt Gene Name: ATP8B4
• UniProt Synonym Gene Names: KIAA1939
• UniProt Entry Name: AT8B4_HUMAN

NCBI Description

This gene encodes a member of the cation transport ATPase (P-type) family and type IV subfamily. The encoded protein is involved in phospholipid transport in the cell membrane. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2013]

Uniprot Description

ATP8B4: Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IV subfamily.

Protein type: Membrane protein, integral; Transporter; Membrane protein, multi-pass; Transporter, ion channel; EC 3.6.3.1; Hydrolase

Chromosomal Location of Human Ortholog: 15q21.2

Cellular Component: Golgi apparatus; integral to membrane; plasma membrane

Molecular Function: phospholipid-translocating ATPase activity; magnesium ion binding; ATP binding

Biological Process: phospholipid translocation; metabolic process; Golgi organization and biogenesis