Mouse anti-Human ATP8B1 Monoclonal Antibody | anti-ATP8B1 antibody

ATP8B1 (Probable Phospholipid-transporting ATPase IC, ATPase Class I Type 8B Member 1, Familial Intrahepatic Cholestasis Type 1, ATPIC, FIC1, PFIC)

Cat. Num. AAA646879

• Gene Names: ATP8B1; BRIC; FIC1; ICP1; PFIC; ATPIC; PFIC1
• Reactivity: Human
• Applications: ELISA
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: ATP8B1; Monoclonal Antibody; ATP8B1 (Probable Phospholipid-transporting ATPase IC; ATPase Class I Type 8B Member 1; Familial Intrahepatic Cholestasis Type 1; ATPIC; FIC1; PFIC); Anti -ATP8B1 (Probable Phospholipid-transporting ATPase IC; anti-ATP8B1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3F10
• Specificity: Recognizes human ATP8B1.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: INGQIYGDHRDASQHNHNKIEQVDFSWNTYADGKLAFYDHYLIEQIQSGKEPEVRQFFFLLAVCHTVMVDRTDGQLNYQAA

• Applicable Applications for anti-ATP8B1 antibody: ELISA (EL/EIA)
• Application Notes: Suitable for use in ELISA.
• Immunogen: Partial recombinant corresponding to aa471-552 from human ATP8B1 (NP_005594) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged ATP8B1 is 1ng/ml as a capture antibody.)

Related Product Information for anti-ATP8B1 antibody

May play a role in the transport of aminophospholipids from the outer to the inner leaflet of various membranes and the maintenance of asymmetric distribution of phospholipids in the canicular membrane. May have a role in transport of bile acids into the canaliculus, uptake of bile acids from intestinal contents into intestinal mucosa or both.

Product Categories/Family for anti-ATP8B1 antibody

Antibodies; Abs to Enzymes; ATPase

NCBI and Uniprot Product Information

• NCBI GI #: 13097633
• NCBI GeneID: 5205
• UniProt Accession #: O43520; Q9BTP8
• Molecular Weight: 143,695 Da
• NCBI Official Full Name: ATP8B1 protein
• NCBI Official Synonym Full Names: ATPase, aminophospholipid transporter, class I, type 8B, member 1
• NCBI Official Symbol: ATP8B1
• NCBI Official Synonym Symbols: BRIC; FIC1; ICP1; PFIC; ATPIC; PFIC1
• NCBI Protein Information: probable phospholipid-transporting ATPase IC; E1-E2 ATPase; ATPase, class I, type 8B, member 1; familial intrahepatic cholestasis type 1
• UniProt Protein Name: Probable phospholipid-transporting ATPase IC
• Protein Family: Phospholipid-transporting ATPase
• UniProt Gene Name: ATP8B1
• UniProt Synonym Gene Names: ATPIC; FIC1; PFIC
• UniProt Entry Name: AT8B1_HUMAN

NCBI Description

This gene encodes a member of the P-type cation transport ATPase family, which belongs to the subfamily of aminophospholipid-transporting ATPases. The aminophospholipid translocases transport phosphatidylserine and phosphatidylethanolamine from one side of a bilayer to another. Mutations in this gene may result in progressive familial intrahepatic cholestasis type 1 and in benign recurrent intrahepatic cholestasis. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: May play a role in the transport of aminophospholipids from the outer to the inner leaflet of various membranes and the maintenance of asymmetric distribution of phospholipids in the canicular membrane. May have a role in transport of bile acids into the canaliculus, uptake of bile acids from intestinal contents into intestinal mucosa or both.

Catalytic activity: ATP + H2O + phospholipid(Side 1) = ADP + phosphate + phospholipid(Side 2).

Subunit structure: Interacts with TMEM30A and TMEM30B. Ref.5

Subcellular location: Cell membrane; Multi-pass membrane protein. Endoplasmic reticulum. Note: Exit from the endoplasmic reticulum requires the presence of TMEM30A or TMEM30B. Ref.5

Tissue specificity: Found in most tissues except brain and skeletal muscle. Most abundant in pancreas and small intestine.

Involvement in disease: Cholestasis, progressive familial intrahepatic, 1 (PFIC1) [MIM:211600]: A disorder characterized by early onset of cholestasis that progresses to hepatic fibrosis, cirrhosis, and end-stage liver disease before adulthood.Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.1 Ref.7 Ref.8Cholestasis, benign recurrent intrahepatic, 1 (BRIC1) [MIM:243300]: A disorder characterized by intermittent episodes of cholestasis without progression to liver failure. There is initial elevation of serum bile acids, followed by cholestatic jaundice which generally spontaneously resolves after periods of weeks to months. The cholestatic attacks vary in severity and duration. Patients are asymptomatic between episodes, both clinically and biochemically.Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.1 Ref.6 Ref.8Cholestasis of pregnancy, intrahepatic 1 (ICP1) [MIM:147480]: A liver disorder of pregnancy. It presents during the second or, more commonly, the third trimester of pregnancy with intense pruritus which becomes more severe with advancing gestation and cholestasis. Cholestasis results from abnormal biliary transport from the liver into the small intestine. ICP1 causes fetal distress, spontaneous premature delivery and intrauterine death. ICP1 patients have spontaneous and progressive disappearance of cholestasis after delivery.Note: The disease may be caused by mutations affecting the gene represented in this entry. Ref.9 Ref.10

Sequence similarities: Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IV subfamily. [View classification]