Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human RPS28 Monoclonal Antibody | anti-RPS28 antibody

RPS28 (40S Ribosomal Protein S28)

Gene Names
RPS28; S28
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
RPS28; Monoclonal Antibody; RPS28 (40S Ribosomal Protein S28); Anti -RPS28 (40S Ribosomal Protein S28); anti-RPS28 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F9
Specificity
Recognizes human RPS28.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MDTSRVQPIKLARVTKVLGRTGSQGQCTQVRVEFMDDTSRSIIRNVKGPVREGDV
Applicable Applications for anti-RPS28 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa1-56 from human RPS28 (NP_001022) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Product Categories/Family for anti-RPS28 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
7,841 Da
NCBI Official Full Name
RPS28
NCBI Official Synonym Full Names
ribosomal protein S28
NCBI Official Symbol
RPS28
NCBI Official Synonym Symbols
S28
NCBI Protein Information
40S ribosomal protein S28
UniProt Protein Name
40S ribosomal protein S28
UniProt Gene Name
RPS28
UniProt Entry Name
RS28_HUMAN

NCBI Description

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S28E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq, Jul 2008]

Uniprot Description

RPS28: Belongs to the ribosomal protein S28e family.

Protein type: Translation; Ribosomal; RNA-binding

Chromosomal Location of Human Ortholog: 19p13.2

Cellular Component: small ribosomal subunit; cytoplasm; cytosol

Molecular Function: structural constituent of ribosome

Biological Process: SRP-dependent cotranslational protein targeting to membrane; ribosomal small subunit biogenesis and assembly; translational elongation; cellular protein metabolic process; viral reproduction; translation; mRNA catabolic process, nonsense-mediated decay; translational initiation; gene expression; viral transcription; translational termination; viral infectious cycle; rRNA processing

Disease: Diamond-blackfan Anemia 15 With Mandibulofacial Dysostosis

Similar Products

Product Notes

The RPS28 rps28 (Catalog #AAA6012661) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RPS28 (40S Ribosomal Protein S28) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RPS28 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the RPS28 rps28 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDTSRVQPIK LARVTKVLGR TGSQGQCTQV RVEFMDDTSR SIIRNVKGPV REGDV. It is sometimes possible for the material contained within the vial of "RPS28, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.