Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (ENTPD5 monoclonal antibody, Western Blot analysis of ENTPD5 expression in HepG2.)

Mouse anti-Human ENTPD5 Monoclonal Antibody | anti-ENTPD5 antibody

ENTPD5 (Ectonucleoside Triphosphate Diphosphohydrolase 5, NTPDase 5, CD39 Antigen-like 4, ER-UDPase, Guanosine-diphosphatase ENTPD5, GDPase ENTPD5, Nucleoside Diphosphatase, Uridine-diphosphatase ENTPD5, UDPase ENTPD5, CD39L4, PCPH)

Gene Names
ENTPD5; PCPH; CD39L4; NTPDase-5
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
ENTPD5; Monoclonal Antibody; ENTPD5 (Ectonucleoside Triphosphate Diphosphohydrolase 5; NTPDase 5; CD39 Antigen-like 4; ER-UDPase; Guanosine-diphosphatase ENTPD5; GDPase ENTPD5; Nucleoside Diphosphatase; Uridine-diphosphatase ENTPD5; UDPase ENTPD5; CD39L4; PCPH); Anti -ENTPD5 (Ectonucleoside Triphosphate Diphosphohydrolase 5; anti-ENTPD5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4A5
Specificity
Recognizes human ENTPD5.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
EEVQRGSFYAFSYYYDRAVDTDMIDYEKGGILKVEDFERKAREVCDNLENFTSGSPFLCMDLSYITALLKDGFGFADSTVLQ
Applicable Applications for anti-ENTPD5 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa319-400 from human ENTPD5 (NP_001240) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(ENTPD5 monoclonal antibody, Western Blot analysis of ENTPD5 expression in HepG2.)

Western Blot (WB) (ENTPD5 monoclonal antibody, Western Blot analysis of ENTPD5 expression in HepG2.)

Testing Data

(Detection limit for recombinant GST tagged ENTPD5 is ~0.3ng/ml as a capture antibody)

Testing Data (Detection limit for recombinant GST tagged ENTPD5 is ~0.3ng/ml as a capture antibody)
Related Product Information for anti-ENTPD5 antibody
CD39L4, also called ENTPD5 (ectonucleoside triphosphate diphosphohydrolase 5), ERUDPase and PCPH, is a secreted, 45-51kD class II member of the GDA1/CD39 NTPase family of molecules. It is expressed by multiple cell types, including neurons, cardiomyocytes, and hepatocytes. CD39L4 is a divalent cation dependent enzyme that preferentially hydrolyzes GDP and UDP. In the ER, this enzyme may remove UDP which interferes with proper protein folding and maturation. Extracellularly, CD39L4 may reduce available UDP ligand for P2Y receptors. Mature human CD39L4 is a 408aa glycoprotein (aa21-428). It contains four APR (apyrase conserved regions) (aa54-206) that participate in NTPase activity. CD39L4 has been reported to exist as both monomer and homodimer. Three potential splice variants are reported. One shows a seven aa substitution for aa401-428, a second contains a five aa substitution for aa401-428, and a third possesses a 22aa substitution for aa215-428. Over aa21-428, human CD39L4 shares 89% aa sequence identity with mouse CD39L4.
Product Categories/Family for anti-ENTPD5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
957
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47,517 Da
NCBI Official Full Name
ectonucleoside triphosphate diphosphohydrolase 5
NCBI Official Synonym Full Names
ectonucleoside triphosphate diphosphohydrolase 5
NCBI Official Symbol
ENTPD5
NCBI Official Synonym Symbols
PCPH; CD39L4; NTPDase-5
NCBI Protein Information
ectonucleoside triphosphate diphosphohydrolase 5; ER-UDPase; NTPDase 5; CD39-like 4; GDPase ENTPD5; UDPase ENTPD5; proto-oncogene CPH; CD39 antigen-like 4; nucleoside diphosphatase; Pcph proto-oncogene protein; uridine-diphosphatase ENTPD5; guanosine-diphosphatase ENTPD5
UniProt Protein Name
Ectonucleoside triphosphate diphosphohydrolase 5
UniProt Gene Name
ENTPD5
UniProt Synonym Gene Names
CD39L4; PCPH; NTPDase 5; GDPase ENTPD5; UDPase ENTPD5
UniProt Entry Name
ENTP5_HUMAN

NCBI Description

The protein encoded by this gene is similar to E-type nucleotidases (NTPases)/ecto-ATPase/apyrases. NTPases, such as CD39, mediate catabolism of extracellular nucleotides. ENTPD5 contains 4 apyrase-conserved regions which is characteristic of NTPases. [provided by RefSeq, Jan 2009]

Uniprot Description

ENTPD5: Uridine diphosphatase (UDPase) that promotes protein N- glycosylation and ATP level regulation. UDP hydrolysis promotes protein N-glycosylation and folding in the endoplasmic reticulum, as well as elevated ATP consumption in the cytosol via an ATP hydrolysis cycle. Together with CMPK1 and AK1, constitutes an ATP hydrolysis cycle that converts ATP to AMP and results in a compensatory increase in aerobic glycolysis. Also hydrolyzes GDP and IDP but not any other nucleoside di-, mono- or triphosphates, nor thiamine pyrophosphate. Plays a key role in the AKT1-PTEN signaling pathway by promoting glycolysis in proliferating cells in response to phosphoinositide 3-kinase (PI3K) signaling. Belongs to the GDA1/CD39 NTPase family.

Protein type: EC 3.6.1.6; EC 3.6.1.42; Hydrolase; Nucleotide Metabolism - pyrimidine; Nucleotide Metabolism - purine; Oncoprotein

Chromosomal Location of Human Ortholog: 14q24

Cellular Component: endoplasmic reticulum

Molecular Function: guanosine-diphosphatase activity; uridine-diphosphatase activity

Biological Process: ATP metabolic process; 'de novo' posttranslational protein folding; cell proliferation; positive regulation of glycolysis; protein amino acid N-linked glycosylation; regulation of phosphoinositide 3-kinase cascade; cell growth

Research Articles on ENTPD5

Similar Products

Product Notes

The ENTPD5 entpd5 (Catalog #AAA6012195) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ENTPD5 (Ectonucleoside Triphosphate Diphosphohydrolase 5, NTPDase 5, CD39 Antigen-like 4, ER-UDPase, Guanosine-diphosphatase ENTPD5, GDPase ENTPD5, Nucleoside Diphosphatase, Uridine-diphosphatase ENTPD5, UDPase ENTPD5, CD39L4, PCPH) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ENTPD5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the ENTPD5 entpd5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EEVQRGSFYA FSYYYDRAVD TDMIDYEKGG ILKVEDFERK AREVCDNLEN FTSGSPFLCM DLSYITALLK DGFGFADSTV LQ. It is sometimes possible for the material contained within the vial of "ENTPD5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.