Testing Data
(Detection limit for recombinant GST tagged NDFIP2 is 0.3ng/ml as a capture antibody.)
Mouse anti-Human NDFIP2 Monoclonal Antibody | anti-NDFIP2 antibody
NDFIP2 (NEDD4 Family-interacting Protein 2, NEDD4 WW Domain-binding Protein 5A, Putative MAPK-activating Protein PM04/PM05/PM06/PM07, Putative NF-kappa-B-activating Protein 413, KIAA1165, N4WBP5A, FLJ25842)
Gene Names
NDFIP2; N4WBP5A
Reactivity
Human
Applications
ELISA
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
NDFIP2; Monoclonal Antibody; NDFIP2 (NEDD4 Family-interacting Protein 2; NEDD4 WW Domain-binding Protein 5A; Putative MAPK-activating Protein PM04/PM05/PM06/PM07; Putative NF-kappa-B-activating Protein 413; KIAA1165; N4WBP5A; FLJ25842); Anti -NDFIP2 (NEDD4 Family-interacting Protein 2; anti-NDFIP2 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2C7
Specificity
Recognizes human NDFIP2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MDHHQPGTGRYQVLLNEEDNSESSAIEQPPTSNPAPQIVQAASSAPALETDSSPPPYSSITVEVPTTSDTEVYGEFYPVPPPYSVATSLPTYDEAEKAKAAAMAAAAAETSQRIQEEECPPRDDFSDADQLRVGNDGIFMLAFFMAFIFNWLGFCLSFCITNTIAGRYGAICGFGLSLIKWILIVRFSDYFTGYFNGQYWLWWIFLVLGLLLFFRGFVNYLKVRNMSESMAAAHRTRYFFLL
Applicable Applications for anti-NDFIP2 antibody
ELISA (EL/EIA)
Application Notes
Suitable for use in ELISA.
Immunogen
Full length recombinant corresponding to aa1-243 from human NDFIP2 (AAH21988) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged NDFIP2 is 0.3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged NDFIP2 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-NDFIP2 antibody
Activates HECT domain-containing E3 ubiquitin-protein ligases, including ITCH, NEDD4, NEDD4L, SMURF2, WWP1 and WWP2, and consequently modulates the stability of their targets. As a result, may control many cellular processes. Recruits ITCH, NEDD4 and SMURF2 to endosomal membranes. May modulate EGFR signaling.
Product Categories/Family for anti-NDFIP2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
36,390 Da
NCBI Official Full Name
NEDD4 family-interacting protein 2 isoform 2
NCBI Official Synonym Full Names
Nedd4 family interacting protein 2
NCBI Official Symbol
NDFIP2
NCBI Official Synonym Symbols
N4WBP5A
NCBI Protein Information
NEDD4 family-interacting protein 2; NF-kappa-B-activating protein 413; NEDD4 WW domain-binding protein 5A; putative NF-kappa-B-activating protein 413; MAPK-activating protein PM04 PM05 PM06 PM07; putative MAPK-activating protein PM04/PM05/PM06/PM07
UniProt Protein Name
NEDD4 family-interacting protein 2
Protein Family
UniProt Gene Name
NDFIP2
UniProt Synonym Gene Names
KIAA1165; N4WBP5A
UniProt Entry Name
NFIP2_HUMAN
Uniprot Description
NDFIP2: Activates HECT domain-containing E3 ubiquitin-protein ligases, including ITCH, NEDD4, NEDD4L, SMURF2, WWP1 and WWP2, and consequently modulates the stability of their targets. As a result, may control many cellular processes. Recruits ITCH, NEDD4 and SMURF2 to endosomal membranes. May modulate EGFR signaling.
Protein type: Membrane protein, integral; Membrane protein, multi-pass; Adaptor/scaffold
Chromosomal Location of Human Ortholog: 13q31.1
Cellular Component: Golgi membrane; Golgi apparatus; intracellular membrane-bound organelle; mitochondrion; perinuclear region of cytoplasm; endoplasmic reticulum; cytoplasm; integral to membrane
Molecular Function: signal transducer activity; protein binding; WW domain binding
Biological Process: positive regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of protein ubiquitination; negative regulation of protein transport; signal transduction; negative regulation of transporter activity
Research Articles on NDFIP2
Similar Products
Product Notes
The NDFIP2 ndfip2 (Catalog #AAA6012085) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NDFIP2 (NEDD4 Family-interacting Protein 2, NEDD4 WW Domain-binding Protein 5A, Putative MAPK-activating Protein PM04/PM05/PM06/PM07, Putative NF-kappa-B-activating Protein 413, KIAA1165, N4WBP5A, FLJ25842) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NDFIP2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA). Suitable for use in ELISA. Researchers should empirically determine the suitability of the NDFIP2 ndfip2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDHHQPGTGR YQVLLNEEDN SESSAIEQPP TSNPAPQIVQ AASSAPALET DSSPPPYSSI TVEVPTTSDT EVYGEFYPVP PPYSVATSLP TYDEAEKAKA AAMAAAAAET SQRIQEEECP PRDDFSDADQ LRVGNDGIFM LAFFMAFIFN WLGFCLSFCI TNTIAGRYGA ICGFGLSLIK WILIVRFSDY FTGYFNGQYW LWWIFLVLGL LLFFRGFVNY LKVRNMSESM AAAHRTRYFF LL. It is sometimes possible for the material contained within the vial of "NDFIP2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
