Western Blot (WB)
(Western Blot analysis of GUCA1C expression in transfected 293T cell line by GUCA1C polyclonal antibody. Lane 1: GUCA1C transfected lysate (23.8kD). Lane 2: Non-transfected lysate.)
Rabbit anti-Human GUCA1C Polyclonal Antibody | anti-GUCA1C antibody
GUCA1C (GCAP3, Guanylyl Cyclase-activating Protein 3, Guanylate Cyclase Activator 1C)
Gene Names
GUCA1C; GCAP3
Reactivity
Human
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
GUCA1C; Polyclonal Antibody; GUCA1C (GCAP3; Guanylyl Cyclase-activating Protein 3; Guanylate Cyclase Activator 1C); Anti -GUCA1C (GCAP3; anti-GUCA1C antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human GUCA1C.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MGNGKSIAGDQKAVPTQETHVWYRTFMMEYPSGLQTLHEFKTLLGLQGLNQKANKHIDQVYNTFDTNKDGFIDFLEFIAAVNLIMQEKMEQKLKWYFKLYDADGNGSIDKNELLDMFMAVQALNGQQTLSPEEFINLVFHKIDINNDGELTLEEFINGMAKDQDLLEIVYKSFDFSNVLRVICNGKQPDMETDSSKSPDKAGLGKVKMK
Applicable Applications for anti-GUCA1C antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human GUCA1C, aa1-209 (NP_005450.2).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of GUCA1C expression in transfected 293T cell line by GUCA1C polyclonal antibody. Lane 1: GUCA1C transfected lysate (23.8kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of GUCA1C expression in transfected 293T cell line by GUCA1C polyclonal antibody. Lane 1: GUCA1C transfected lysate (23.8kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-GUCA1C antibody
GUCA1C stimulates guanylyl cyclase 1 (GC1) and GC2 when free calcium ions concentration is low and inhibits guanylyl cyclases when free calcium ions concentration is elevated. This Ca(2+)-sensitive regulation of guanylyl cyclase (GC) is a key event in recovery of the dark state of rod photoreceptors following light exposure.
Product Categories/Family for anti-GUCA1C antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
23,822 Da
NCBI Official Full Name
guanylyl cyclase-activating protein 3
NCBI Official Synonym Full Names
guanylate cyclase activator 1C
NCBI Official Symbol
GUCA1C
NCBI Official Synonym Symbols
GCAP3
NCBI Protein Information
guanylyl cyclase-activating protein 3; GCAP 3
UniProt Protein Name
Guanylyl cyclase-activating protein 3
Protein Family
UniProt Gene Name
GUCA1C
UniProt Synonym Gene Names
GCAP3; GCAP 3
UniProt Entry Name
GUC1C_HUMAN
Uniprot Description
GUCA1C: Stimulates guanylyl cyclase 1 (GC1) and GC2 when free calcium ions concentration is low and inhibits guanylyl cyclases when free calcium ions concentration is elevated. This Ca(2+)- sensitive regulation of guanylyl cyclase (GC) is a key event in recovery of the dark state of rod photoreceptors following light exposure. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Calcium-binding; Activator
Chromosomal Location of Human Ortholog: 3q13.1
Molecular Function: calcium sensitive guanylate cyclase activator activity; calcium ion binding
Biological Process: rhodopsin mediated signaling; phototransduction, visible light; regulation of rhodopsin mediated signaling; visual perception; positive regulation of guanylate cyclase activity; signal transduction
Research Articles on GUCA1C
Similar Products
Product Notes
The GUCA1C guca1c (Catalog #AAA6011868) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GUCA1C (GCAP3, Guanylyl Cyclase-activating Protein 3, Guanylate Cyclase Activator 1C) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GUCA1C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the GUCA1C guca1c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGNGKSIAGD QKAVPTQETH VWYRTFMMEY PSGLQTLHEF KTLLGLQGLN QKANKHIDQV YNTFDTNKDG FIDFLEFIAA VNLIMQEKME QKLKWYFKLY DADGNGSIDK NELLDMFMAV QALNGQQTLS PEEFINLVFH KIDINNDGEL TLEEFINGMA KDQDLLEIVY KSFDFSNVLR VICNGKQPDM ETDSSKSPDK AGLGKVKMK. It is sometimes possible for the material contained within the vial of "GUCA1C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
