Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human TMSB4Y Monoclonal Antibody | anti-TMSB4Y antibody

TMSB4Y (Thymosin beta-4, Y-chromosomal, TB4Y)

Gene Names
TMSB4Y; TB4Y
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
TMSB4Y; Monoclonal Antibody; TMSB4Y (Thymosin beta-4; Y-chromosomal; TB4Y); Anti -TMSB4Y (Thymosin beta-4; anti-TMSB4Y antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6G4
Specificity
Recognizes human TMSB4Y.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MSDKPGMAEIEKFDKSKLKKTETQEKNPLSSKETIEQERQAGES
Applicable Applications for anti-TMSB4Y antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Full length recombinant corresponding to aa1-44 from TMSB4Y (NP_004193.1) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Product Categories/Family for anti-TMSB4Y antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
5,013 Da
NCBI Official Full Name
thymosin beta-4, Y-chromosomal
NCBI Official Synonym Full Names
thymosin beta 4, Y-linked
NCBI Official Symbol
TMSB4Y
NCBI Official Synonym Symbols
TB4Y
NCBI Protein Information
thymosin beta-4, Y-chromosomal; thymosin beta-4, Y isoform; thymosin, beta 4, Y chromosome
UniProt Protein Name
Thymosin beta-4, Y-chromosomal
Protein Family
UniProt Gene Name
TMSB4Y
UniProt Synonym Gene Names
TB4Y
UniProt Entry Name
TYB4Y_HUMAN

NCBI Description

This gene lies within the male specific region of chromosome Y. Its homolog on chromosome X escapes X inactivation and encodes an actin sequestering protein. [provided by RefSeq, Jul 2008]

Uniprot Description

TMSB4Y: Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization. Belongs to the thymosin beta family.

Protein type: Cytoskeletal

Chromosomal Location of Human Ortholog: Yq11.221

Cellular Component: cytoskeleton; cytoplasm

Molecular Function: actin monomer binding

Biological Process: sequestering of actin monomers; regulation of actin polymerization and/or depolymerization; actin filament organization

Research Articles on TMSB4Y

Similar Products

Product Notes

The TMSB4Y tmsb4y (Catalog #AAA6011425) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TMSB4Y (Thymosin beta-4, Y-chromosomal, TB4Y) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TMSB4Y can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the TMSB4Y tmsb4y for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSDKPGMAEI EKFDKSKLKK TETQEKNPLS SKETIEQERQ AGES. It is sometimes possible for the material contained within the vial of "TMSB4Y, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.