Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of MTCP1 expression in transfected 293T cell line by MTCP1 polyclonal antibody. Lane 1: MTCP1 transfected lysate (7.59kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human CMC4 Polyclonal Antibody | anti-CMC4 antibody

CMC4 (Mature T-cell Proliferation 1 Neighbor Protein, Cx9C Motif-containing Protein 4, Mature T-cell Proliferation-1 Type A, MTCP-1 type A, Protein p8 MTCP-1, p8MTCP1, C6.1B, MTCP1, MTCP1NB)

Gene Names
CMC4; p8; C6.1B; MTCP1; MTCP1B; MTCP1NB; p8MTCP1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
CMC4; Polyclonal Antibody; CMC4 (Mature T-cell Proliferation 1 Neighbor Protein; Cx9C Motif-containing Protein 4; Mature T-cell Proliferation-1 Type A; MTCP-1 type A; Protein p8 MTCP-1; p8MTCP1; C6.1B; MTCP1; MTCP1NB); Anti -CMC4 (Mature T-cell Proliferation 1 Neighbor Protein; anti-CMC4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human MTCP1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MPQKDPCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKSASK
Applicable Applications for anti-CMC4 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human MTCP1, aa1-68 (AAH02600).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of MTCP1 expression in transfected 293T cell line by MTCP1 polyclonal antibody. Lane 1: MTCP1 transfected lysate (7.59kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MTCP1 expression in transfected 293T cell line by MTCP1 polyclonal antibody. Lane 1: MTCP1 transfected lysate (7.59kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-CMC4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
7,747 Da
NCBI Official Full Name
cx9C motif-containing protein 4
NCBI Official Synonym Full Names
C-x(9)-C motif containing 4 homolog (S. cerevisiae)
NCBI Official Symbol
CMC4
NCBI Official Synonym Symbols
p8; C6.1B; MTCP1; MTCP1B; MTCP1NB; p8MTCP1
NCBI Protein Information
cx9C motif-containing protein 4; MTCP-1 type A; protein p8 MTCP-1; mature T-cell proliferation-1 type A; mature T-cell proliferation 1, isoform p8; mature T-cell proliferation 1 neighbor protein
UniProt Protein Name
Cx9C motif-containing protein 4
UniProt Gene Name
CMC4
UniProt Synonym Gene Names
C6.1B; MTCP1; MTCP1NB; MTCP-1 type A; p8MTCP1
UniProt Entry Name
CMC4_HUMAN

NCBI Description

This gene was identified by involvement in some t(X;14) translocations associated with mature T-cell proliferations. This region has a complex gene structure, with a common promoter and 5' exon spliced to two different sets of 3' exons that encode two different proteins. This gene represents the downstream 8 kDa protein that localizes to mitochondria.[provided by RefSeq, Mar 2009]

Uniprot Description

MTCPA: Overexpressed in T-cell leukemia bearing a t(X;14) translocation. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Oncoprotein

Chromosomal Location of Human Ortholog: Xq28

Cellular Component: mitochondrion

Biological Process: cell proliferation

Similar Products

Product Notes

The CMC4 cmc4 (Catalog #AAA6010673) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CMC4 (Mature T-cell Proliferation 1 Neighbor Protein, Cx9C Motif-containing Protein 4, Mature T-cell Proliferation-1 Type A, MTCP-1 type A, Protein p8 MTCP-1, p8MTCP1, C6.1B, MTCP1, MTCP1NB) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CMC4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the CMC4 cmc4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MPQKDPCQKQ ACEIQKCLQA NSYMESKCQA VIQELRKCCA QYPKGRSVVC SGFEKEEEEN LTRKSASK. It is sometimes possible for the material contained within the vial of "CMC4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.