Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunoprecipitation (IP) (Immunoprecipitation of OTX1 transfected lysate using OTX1 rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with OTX1 monoclonal antibody.)

Rabbit anti-Human OTX1 Polyclonal Antibody

OTX1 (Homeobox Protein OTX1, Orthodenticle Homolog 1, FLJ38361, MGC15736)

Reactivity
Human
Applications
Immunoprecipitation
Purity
Serum
Serum
Synonyms
OTX1; Polyclonal Antibody; OTX1 (Homeobox Protein OTX1; Orthodenticle Homolog 1; FLJ38361; MGC15736); Anti -OTX1 (Homeobox Protein OTX1; anti-OTX1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human OTX1.
Purity/Purification
Serum
Serum
Form/Format
Supplied as a liquid.
Sequence
MMSYLKQPPYGMNGLGLAGPAMDLLHPSVGYPATPRKQRRERTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQSGSGTKSRPAKKKSSPVRESSGSESSGQFTPPAVSSSASSSSSASSSSANPAAAAAAGLGGNPVAAASSLSTPAASSIWSPASISPGSAPASVSVPEPLAAPSNTSCMQRSVAAGAATAAASYPMSYGQGGSYGQGYPTPSSSYFGGVDCSSYLAPMHSHHHPHQLSPMAPSSMAGHHHHHPHAHHPLSQSSGHHHHHHHHHHQGYGGSGLAFNSADCLDYKEPGAAAASSAWKLNFNSPDCLDYKDQASWRFQVL
Applicable Applications for anti-OTX1 antibody
Immunoprecipitation (IP)
Application Notes
Suitable for use in Immunoprecipitation.
Immunogen
Full length human OTX1, aa1-354 (NP_055377.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunoprecipitation (IP)

(Immunoprecipitation of OTX1 transfected lysate using OTX1 rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with OTX1 monoclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of OTX1 transfected lysate using OTX1 rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with OTX1 monoclonal antibody.)
Related Product Information for anti-OTX1 antibody
This gene encodes a member of the bicoid sub-family of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mice is required for proper brain and sensory organ development and can cause epilepsy.
Product Categories/Family for anti-OTX1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Official Full Name
Otx1
Protein Family

Similar Products

Product Notes

The OTX1 (Catalog #AAA6010613) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The OTX1 (Homeobox Protein OTX1, Orthodenticle Homolog 1, FLJ38361, MGC15736) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's OTX1 can be used in a range of immunoassay formats including, but not limited to, Immunoprecipitation (IP). Suitable for use in Immunoprecipitation. Researchers should empirically determine the suitability of the OTX1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MMSYLKQPPY GMNGLGLAGP AMDLLHPSVG YPATPRKQRR ERTTFTRSQL DVLEALFAKT RYPDIFMREE VALKINLPES RVQVWFKNRR AKCRQQQQSG SGTKSRPAKK KSSPVRESSG SESSGQFTPP AVSSSASSSS SASSSSANPA AAAAAGLGGN PVAAASSLST PAASSIWSPA SISPGSAPAS VSVPEPLAAP SNTSCMQRSV AAGAATAAAS YPMSYGQGGS YGQGYPTPSS SYFGGVDCSS YLAPMHSHHH PHQLSPMAPS SMAGHHHHHP HAHHPLSQSS GHHHHHHHHH HQGYGGSGLA FNSADCLDYK EPGAAAASSA WKLNFNSPDC LDYKDQASWR FQVL. It is sometimes possible for the material contained within the vial of "OTX1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.