Mouse anti-Human, Mouse ZNF624 Polyclonal Antibody | anti-ZNF624 antibody

ZNF624 (Zinc Finger Protein 624, KIAA1349)

Cat. Num. AAA6009840

• Reactivity: Human, Mouse
• Applications: Western Blot, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: ZNF624; Polyclonal Antibody; ZNF624 (Zinc Finger Protein 624; KIAA1349); Anti -ZNF624 (Zinc Finger Protein 624; anti-ZNF624 antibody

• Host: Mouse
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human ZNF624. Species Crossreactivity: mouse.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MEPKPATKKATRTKAISEDLSQEAILEKLTENGLWDSRMEGLWKWNDRILRLQNNQENHLSQRIIPLKKTPTSQRGFRFESILIPEPGIATEELHSRCQTQEENFTENLNLITDTHLGKIICKEMKGSKAIRQTSELTLGKKSNNKEKPYKCSTCEKAFHYRSLLIQHQRTHTKEKPYECNECGKTFSQPSYLSQHKKIHTGEKPYKCNECGKAFIASSSLMVHQRIHTKEKPYQCNVCGKSFSQCARLNQHQRIQTGEKPYKCSECGKAFSDKSKLARHQETHNGEKPYKCDDCGKAFRNKSYLSVHQKTHTEEKPYQCNECGKSFKNTTIFNVHQRIHTGEKPFRCNECGKAYRSNSSLIVHIRTHTGEKPYECNECGKAFNRIANFTEHQRIHTGEKPYKCNECGKAFINYSCLTVHHRMHTGEKPYKCTECGKAFMRSSSLIIHQRIHTEEKPYLCNECGESFRIKSHLTVHQRIHTGEKPYKCTDCERAFTKMVNLKEHQKIHTGVKPYKCYDCGKSFRTKSYLIVHQRTHTGEKPYKCNECEKAFTNTSQLTVHQRRHTGEKPYKCNECGKVFTSNSGFNTHQRTHTGEKPFKCNDCGKAFSQMVHVTEHQKIHTGEKPYKCDVCGKAFRRGSYLTVHWRTHTGEKPYTCKECGKGCITLSQLTLHQRIHTGERPYKCEECGKAFRTNSDFTVHLRMHTGEKPYKCNECGKAFRSSSSLTVHQRIHQRETQLI

• Applicable Applications for anti-ZNF624 antibody: Western Blot (WB), Immunofluorescence (IF)
• Application Notes: Suitable for use in Immunofluorescence and Western Blot.; Dilution: Immunofluorescence: 10ug/ml
• Immunogen: Full length human ZNF624, aa1-739 (AAI03947.1).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(ZNF624 polyclonal antibody. Western Blot analysis of ZNF624 expression in HepG2.)

Western Blot (WB)

(ZNF624 polyclonal antibody. Western Blot analysis of ZNF624 expression in Raw 264.7.)

Western Blot (WB)

(Western Blot analysis of ZNF624 expression in transfected 293T cell line by ZNF624 polyclonal antibody. Lane 1: ZNF624 transfected lysate (81.29kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to ZNF624 on HeLa cell. [antibody concentration 10ug/ml].)

Product Categories/Family for anti-ZNF624 antibody

Antibodies; Abs to Transcription Factors; Zinc (Ring) Finger

NCBI and Uniprot Product Information

• NCBI GI #: 74355161
• NCBI GeneID: 57547
• UniProt Accession #: Q9P2J8; Q3SY62; Q3SY63; Q6ZN27
• Molecular Weight: 99,929 Da
• NCBI Official Full Name: ZNF624 protein
• NCBI Official Synonym Full Names: zinc finger protein 624
• NCBI Official Symbol: ZNF624
• NCBI Protein Information: zinc finger protein 624
• UniProt Protein Name: Zinc finger protein 624
• Protein Family: Zinc finger protein
• UniProt Gene Name: ZNF624
• UniProt Synonym Gene Names: KIAA1349
• UniProt Entry Name: ZN624_HUMAN

Uniprot Description

ZNF624: May be involved in transcriptional regulation. Belongs to the krueppel C2H2-type zinc-finger protein family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 17p11.2

Cellular Component: nucleus

Molecular Function: DNA binding; metal ion binding; transcription factor activity

Biological Process: regulation of transcription, DNA-dependent; transcription, DNA-dependent