Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (ZNF468 polyclonal antibody. Western Blot analysis of ZNF468 expression in human pancreas.)

Mouse anti-Human ZNF468 Polyclonal Antibody | anti-ZNF468 antibody

ZNF468 (Zinc Finger Protein 468)

Reactivity
Human
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
ZNF468; Polyclonal Antibody; ZNF468 (Zinc Finger Protein 468); Anti -ZNF468 (Zinc Finger Protein 468); anti-ZNF468 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ZNF468.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MLKTLSSTGQGNTEVIHTGTLHRQASHHIGEFCFHEIEKDIHGFEFQWKEDETNGHAAPMTEIKELAGSTGQHDQRHAGNKRIKDQLGSSFHLHLPEPHIFQSEGKIGNQVEKSINNASSVSTSQRICCRPKTHISNKYGNNSLHSSLLTQKWEVHMREKSFECIQSFKSFNCSSLLKKHQIIHLEEKQCKCDVCGKVFNQKRYLACHRRCHTGEKPYKCNECGKTFGHNSSLFIHKALHTGEKPYECEECDKVFSRKSHLERHKRIHTGEKPYKCKVCDEAFAYNSYLAKHTILHTGEKPYTCNECGKVFNRLSTLARHHRLHTGEKPYKCEECDKVFSRKSHLERHRRIHSGEKPYKCEECCKVFSRKSNLERHRRIHTGEKPYKCKVCDKAFQRDSHLAQHQRVHTGEKPYKCNECGKTFGQTSSLIIHRRLHTGEKPYKCNECGKTFSQMSSLVYHHRLHSGEKP
Applicable Applications for anti-ZNF468 antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Full length human ZNF468, aa1-469 (NP_954583.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(ZNF468 polyclonal antibody. Western Blot analysis of ZNF468 expression in human pancreas.)

Western Blot (WB) (ZNF468 polyclonal antibody. Western Blot analysis of ZNF468 expression in human pancreas.)

Western Blot (WB)

(Western Blot analysis of ZNF468 expression in transfected 293T cell line by ZNF468 polyclonal antibody. Lane 1: ZNF468 transfected lysate (51.59kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ZNF468 expression in transfected 293T cell line by ZNF468 polyclonal antibody. Lane 1: ZNF468 transfected lysate (51.59kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to ZNF468 on HepG2 cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of purified antibody to ZNF468 on HepG2 cell. [antibody concentration 10ug/ml].)
Product Categories/Family for anti-ZNF468 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60,573 Da
NCBI Official Full Name
zinc finger protein 468 isoform 3
NCBI Official Synonym Full Names
zinc finger protein 468
NCBI Official Symbol
ZNF468
NCBI Protein Information
zinc finger protein 468; zinc finger protein ZNF468
UniProt Protein Name
Zinc finger protein 468
Protein Family
UniProt Gene Name
ZNF468
UniProt Entry Name
ZN468_HUMAN

Uniprot Description

ZNF468: May be involved in transcriptional regulation. Belongs to the krueppel C2H2-type zinc-finger protein family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription regulation; DNA-binding; C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 19q13.41

Cellular Component: nucleus

Molecular Function: DNA binding; metal ion binding

Biological Process: regulation of transcription, DNA-dependent; transcription, DNA-dependent

Research Articles on ZNF468

Similar Products

Product Notes

The ZNF468 znf468 (Catalog #AAA6009348) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ZNF468 (Zinc Finger Protein 468) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF468 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the ZNF468 znf468 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MLKTLSSTGQ GNTEVIHTGT LHRQASHHIG EFCFHEIEKD IHGFEFQWKE DETNGHAAPM TEIKELAGST GQHDQRHAGN KRIKDQLGSS FHLHLPEPHI FQSEGKIGNQ VEKSINNASS VSTSQRICCR PKTHISNKYG NNSLHSSLLT QKWEVHMREK SFECIQSFKS FNCSSLLKKH QIIHLEEKQC KCDVCGKVFN QKRYLACHRR CHTGEKPYKC NECGKTFGHN SSLFIHKALH TGEKPYECEE CDKVFSRKSH LERHKRIHTG EKPYKCKVCD EAFAYNSYLA KHTILHTGEK PYTCNECGKV FNRLSTLARH HRLHTGEKPY KCEECDKVFS RKSHLERHRR IHSGEKPYKC EECCKVFSRK SNLERHRRIH TGEKPYKCKV CDKAFQRDSH LAQHQRVHTG EKPYKCNECG KTFGQTSSLI IHRRLHTGEK PYKCNECGKT FSQMSSLVYH HRLHSGEKP. It is sometimes possible for the material contained within the vial of "ZNF468, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.