Mouse anti-Human ZNF468 Polyclonal Antibody | anti-ZNF468 antibody

ZNF468 (Zinc Finger Protein 468)

Cat. Num. AAA6009348

• Reactivity: Human
• Applications: Western Blot, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: ZNF468; Polyclonal Antibody; ZNF468 (Zinc Finger Protein 468); Anti -ZNF468 (Zinc Finger Protein 468); anti-ZNF468 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human ZNF468.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MLKTLSSTGQGNTEVIHTGTLHRQASHHIGEFCFHEIEKDIHGFEFQWKEDETNGHAAPMTEIKELAGSTGQHDQRHAGNKRIKDQLGSSFHLHLPEPHIFQSEGKIGNQVEKSINNASSVSTSQRICCRPKTHISNKYGNNSLHSSLLTQKWEVHMREKSFECIQSFKSFNCSSLLKKHQIIHLEEKQCKCDVCGKVFNQKRYLACHRRCHTGEKPYKCNECGKTFGHNSSLFIHKALHTGEKPYECEECDKVFSRKSHLERHKRIHTGEKPYKCKVCDEAFAYNSYLAKHTILHTGEKPYTCNECGKVFNRLSTLARHHRLHTGEKPYKCEECDKVFSRKSHLERHRRIHSGEKPYKCEECCKVFSRKSNLERHRRIHTGEKPYKCKVCDKAFQRDSHLAQHQRVHTGEKPYKCNECGKTFGQTSSLIIHRRLHTGEKPYKCNECGKTFSQMSSLVYHHRLHSGEKP

• Applicable Applications for anti-ZNF468 antibody: Western Blot (WB), Immunofluorescence (IF)
• Application Notes: Suitable for use in Immunofluorescence and Western Blot.; Dilution: Immunofluorescence: 10ug/ml
• Immunogen: Full length human ZNF468, aa1-469 (NP_954583.1).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(ZNF468 polyclonal antibody. Western Blot analysis of ZNF468 expression in human pancreas.)

Western Blot (WB)

(Western Blot analysis of ZNF468 expression in transfected 293T cell line by ZNF468 polyclonal antibody. Lane 1: ZNF468 transfected lysate (51.59kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to ZNF468 on HepG2 cell. [antibody concentration 10ug/ml].)

Product Categories/Family for anti-ZNF468 antibody

Antibodies; Abs to Transcription Factors; Zinc (Ring) Finger

NCBI and Uniprot Product Information

• NCBI GI #: 459683861
• NCBI GeneID: 90333
• NCBI Accession #: NP_001264049.1
• NCBI GenBank Nucleotide #: NM_001277120.1
• UniProt Accession #: Q5VIY5; Q5CZB8; Q5VIY4; Q68DI7; A8MV20
• Molecular Weight: 60,573 Da
• NCBI Official Full Name: zinc finger protein 468 isoform 3
• NCBI Official Synonym Full Names: zinc finger protein 468
• NCBI Official Symbol: ZNF468
• NCBI Protein Information: zinc finger protein 468; zinc finger protein ZNF468
• UniProt Protein Name: Zinc finger protein 468
• Protein Family: Zinc finger protein
• UniProt Gene Name: ZNF468
• UniProt Entry Name: ZN468_HUMAN

Uniprot Description

ZNF468: May be involved in transcriptional regulation. Belongs to the krueppel C2H2-type zinc-finger protein family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription regulation; DNA-binding; C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 19q13.41

Cellular Component: nucleus

Molecular Function: DNA binding; metal ion binding

Biological Process: regulation of transcription, DNA-dependent; transcription, DNA-dependent