Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (C1QBP rabbit polyclonal antibody. Western Blot analysis of C1QBP expression in Hela NE.)

Rabbit anti-Human GC1qR Polyclonal Antibody

GC1qR (Complement Component 1 Q Subcomponent-binding Protein Mitochondrial, Glycoprotein gC1qBP, C1qBP, GC1q-R Protein, GC1QBP, Hyaluronan-binding Protein 1, HABP1, Mitochondrial Matrix Protein p32, p33, SF2P32)

Reactivity
Human
Applications
Western Blot
Purity
Serum
Serum
Synonyms
GC1qR; Polyclonal Antibody; GC1qR (Complement Component 1 Q Subcomponent-binding Protein Mitochondrial; Glycoprotein gC1qBP; C1qBP; GC1q-R Protein; GC1QBP; Hyaluronan-binding Protein 1; HABP1; Mitochondrial Matrix Protein p32; p33; SF2P32); Anti -GC1qR (Complement Component 1 Q Subcomponent-binding Protein Mitochondrial; anti-GC1qR antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human C1QBP.
Purity/Purification
Serum
Serum
Form/Format
Supplied as a liquid.
Sequence
MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLRPRGPCACGCGCGSLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ
Applicable Applications for anti-GC1qR antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human C1QBP, aa1-282 (NP_001203.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(C1QBP rabbit polyclonal antibody. Western Blot analysis of C1QBP expression in Hela NE.)

Western Blot (WB) (C1QBP rabbit polyclonal antibody. Western Blot analysis of C1QBP expression in Hela NE.)

Western Blot (WB)

(Western Blot analysis of C1QBP expression in transfected 293T cell line by C1QBP polyclonal antibody. Lane 1: C1QBP transfected lysate (31.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of C1QBP expression in transfected 293T cell line by C1QBP polyclonal antibody. Lane 1: C1QBP transfected lysate (31.4kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-GC1qR antibody
The human complement subcomponent C1q associates with C1r and C1s in order to yield the first component of the serum complement system. C1QBP is known to bind to the globular heads of C1q molecules and inhibit C1 activation. This protein has also been identified as the p32 subunit of pre-mRNA splicing factor SF2, as well as a hyaluronic acid-binding protein.
Product Categories/Family for anti-GC1qR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Official Full Name
gC1qR

Similar Products

Product Notes

The GC1qR (Catalog #AAA6007604) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GC1qR (Complement Component 1 Q Subcomponent-binding Protein Mitochondrial, Glycoprotein gC1qBP, C1qBP, GC1q-R Protein, GC1QBP, Hyaluronan-binding Protein 1, HABP1, Mitochondrial Matrix Protein p32, p33, SF2P32) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GC1qR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the GC1qR for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MLPLLRCVPR VLGSSVAGLR AAAPASPFRQ LLQPAPRLCT RPFGLLSVRA GSERRPGLLR PRGPCACGCG CGSLHTDGDK AFVDFLSDEI KEERKIQKHK TLPKMSGGWE LELNGTEAKL VRKVAGEKIT VTFNINNSIP PTFDGEEEPS QGQKVEEQEP ELTSTPNFVV EVIKNDDGKK ALVLDCHYPE DEVGQEDEAE SDIFSIREVS FQSTGESEWK DTNYTLNTDS LDWALYDHLM DFLADRGVDN TFADELVELS TALEHQEYIT FLEDLKSFVK SQ. It is sometimes possible for the material contained within the vial of "GC1qR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.