Mouse anti-Human RPAIN Polyclonal Antibody | anti-RPAIN antibody

RPAIN (RPA-interacting Protein, RIP, hRIP)

Cat. Num. AAA6006584

• Gene Names: RPAIN; RIP; HRIP
• Reactivity: Human
• Applications: Western Blot, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: RPAIN; Polyclonal Antibody; RPAIN (RPA-interacting Protein; RIP; hRIP); Anti -RPAIN (RPA-interacting Protein; anti-RPAIN antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human RPAIN.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MAESLRSPRRSLYKLVGSPPWKEAFRQRCLERMRNSRDRLLNRYRQAGSSGPGNSQNSFLVQEVMEEEWNALQSVENCPEDLAQLEELIDMAVLEEIQQELIKQEQSIISEYEKSLQFDEKCLSIMLAEWEANPLICPVCTKYNLRITSGVVVCQCGLSIPSHSSELTEQKLRACLEGSINEHSAHCPHTPEFSVTGGTEEKSSLLMSCLACDTWAVIL

• Applicable Applications for anti-RPAIN antibody: Western Blot (WB), Immunofluorescence (IF)
• Application Notes: Suitable for use in Immunofluorescence and Western Blot.; Dilution: Immunofluorescence: 10ug/ml
• Immunogen: Full length human RPAIN, aa1-219 (NP_001028174.1).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(RIP polyclonal antibody. Western Blot analysis of RIP expression in human placenta.)

Western Blot (WB)

(Western Blot analysis of RPAIN expression in transfected 293T cell line by RPAIN polyclonal antibody. Lane 1: RIP transfected lysate (24.09kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to RIP on HeLa cell. [antibody concentration 10ug/ml].)

Product Categories/Family for anti-RPAIN antibody

Antibodies; Abs to DNA Replication; Repair

NCBI and Uniprot Product Information

• NCBI GI #: 13325269
• NCBI GeneID: 84268
• UniProt Accession #: Q86UA6; Q4G2Y0; Q4G2Y5; Q4G2Y8; Q6B4V9; Q6B4W0; Q6B4W1; Q6B4W4; B4DI36; B4DTX7; E9PES3; J3KNH8
• Molecular Weight: 24,784 Da
• NCBI Official Full Name: RPAIN protein
• NCBI Official Synonym Full Names: RPA interacting protein
• NCBI Official Symbol: RPAIN
• NCBI Official Synonym Symbols: RIP; HRIP
• NCBI Protein Information: RPA-interacting protein; nuclear transporter; RAP interaction protein
• UniProt Protein Name: RPA-interacting protein
• Protein Family: RPA-interacting protein
• UniProt Gene Name: RPAIN
• UniProt Synonym Gene Names: RIP; hRIP
• UniProt Entry Name: RIP_HUMAN

Uniprot Description

RPAIN: Mediates the import of RPA complex into the nucleus, possibly via some interaction with importin beta. Isoform 2 is sumoylated and mediates the localization of RPA complex into the PML body of the nucleus, thereby participating in RPA function in DNA metabolism. 7 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA replication; DNA repair, damage

Chromosomal Location of Human Ortholog: 17p13.2

Cellular Component: PML body; cytoplasm; nucleolus; nucleus

Molecular Function: metal ion binding; protein complex binding

Biological Process: protein import into nucleus; DNA repair; DNA-dependent DNA replication; response to UV; DNA recombination