Mouse anti-Human FBXL17 Monoclonal Antibody | anti-FBXL17 antibody
FBXL17 (F-box/LRR-repeat Protein 17, F-box and Leucine-rich Repeat Protein 17, F-box Only Protein 13, FBL17, FBX13, FBXO13, DKFZp434C1715, DKFZP434C1715, MGC161422, MGC161424)
Gene Names
FBXL17; Fbl17; Fbx13; FBXO13
Reactivity
Human
Applications
ELISA
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
FBXL17; Monoclonal Antibody; FBXL17 (F-box/LRR-repeat Protein 17; F-box and Leucine-rich Repeat Protein 17; F-box Only Protein 13; FBL17; FBX13; FBXO13; DKFZp434C1715; DKFZP434C1715; MGC161422; MGC161424); Anti -FBXL17 (F-box/LRR-repeat Protein 17; anti-FBXL17 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
6C12
Specificity
Recognizes human FBXL17.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
QNLKELYLVSCKITDYALIAIGRYSMTIETVDVGWCKEITDQGATLIAQSSKSLRYLGLMRCDKVNEVTVEQLVQQYPHITFSTVLQDCKRTLERAYQMGWTPNMSAASS
Applicable Applications for anti-FBXL17 antibody
ELISA (EL/EIA)
Application Notes
Suitable for use in ELISA.
Immunogen
Partial recombinant corresponding to aa194-304 from human FBXL17 (NP_073735) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Related Product Information for anti-FBXL17 antibody
Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.
Product Categories/Family for anti-FBXL17 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
75,695 Da
NCBI Official Full Name
F-box/LRR-repeat protein 17
NCBI Official Synonym Full Names
F-box and leucine-rich repeat protein 17
NCBI Official Symbol
FBXL17
NCBI Official Synonym Symbols
Fbl17; Fbx13; FBXO13
NCBI Protein Information
F-box/LRR-repeat protein 17; F-box only protein 13
UniProt Protein Name
F-box/LRR-repeat protein 17
Protein Family
UniProt Gene Name
FBXL17
UniProt Synonym Gene Names
FBL17; FBX13; FBXO13
UniProt Entry Name
FXL17_HUMAN
NCBI Description
Members of the F-box protein family, such as FBXL17, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM, Mar 2008]
Uniprot Description
FBXL17: Substrate-recognition component of the SCF (SKP1-CUL1-F- box protein)-type E3 ubiquitin ligase complex. 3 isoforms of the human protein are produced by alternative splicing.
Chromosomal Location of Human Ortholog: 5q21.3
Research Articles on FBXL17
Similar Products
Product Notes
The FBXL17 fbxl17 (Catalog #AAA6006358) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FBXL17 (F-box/LRR-repeat Protein 17, F-box and Leucine-rich Repeat Protein 17, F-box Only Protein 13, FBL17, FBX13, FBXO13, DKFZp434C1715, DKFZP434C1715, MGC161422, MGC161424) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FBXL17 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA). Suitable for use in ELISA. Researchers should empirically determine the suitability of the FBXL17 fbxl17 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QNLKELYLVS CKITDYALIA IGRYSMTIET VDVGWCKEIT DQGATLIAQS SKSLRYLGLM RCDKVNEVTV EQLVQQYPHI TFSTVLQDCK RTLERAYQMG WTPNMSAASS. It is sometimes possible for the material contained within the vial of "FBXL17, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
