Mouse anti-Human SLC11A1 Polyclonal Antibody | anti-SLC11A1 antibody

SLC11A1 (Natural Resistance-associated Macrophage Protein 1, NRAMP 1, LSH, NRAMP, NRAMP1)

Cat. Num. AAA6005974

• Gene Names: SLC11A1; LSH; NRAMP; NRAMP1
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: SLC11A1; Polyclonal Antibody; SLC11A1 (Natural Resistance-associated Macrophage Protein 1; NRAMP 1; LSH; NRAMP; NRAMP1); Anti -SLC11A1 (Natural Resistance-associated Macrophage Protein 1; anti-SLC11A1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human SLC11A1.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MTGDKGPQRLSGSSYGSISSPTSPTSPGPQQAPPRETYLRNIESDLQAGAVAGFKLLWVLLWATVLGLLCQRLAARLGVVTGKDLGEVCHLYYPKVPRTVLWLTIELAIVGSDMQEVIGTAIAFNLLSAGRYHPSVPQLFRPGREQLLLLPPLTSPSQSLFYPAVPSEAGLLPCFPEM

• Applicable Applications for anti-SLC11A1 antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full length human SLC11A1, aa1-178 (AAH41787.1).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of SLC11A1 expression in transfected 293T cell line by SLC11A1 polyclonal antibody. Lane 1: SLC11A1 transfected lysate (19.58kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-SLC11A1 antibody

NRAMP1, also known as SLC11A1, is a member of the solute carrier family 11 (proton-coupled divalent metal ion transporters) family and encodes a multi-pass membrane protein. The protein functions as a divalent transition metal (iron and manganese) transporter involved in iron metabolism and host resistance to certain pathogens. Mutations in this gene have been associated with susceptibility to infectious diseases such as leprosy and tuberculosis, and inflammatory diseases such as Crohn disease and rheumatoid arthritis. Alternatively spliced variants that encode different protein isoforms have been described but the full-length nature of only one has been determined.

Product Categories/Family for anti-SLC11A1 antibody

Antibodies; Abs to Ion Channel

NCBI and Uniprot Product Information

• NCBI GI #: 49256585
• NCBI GeneID: 6556
• UniProt Accession #: P49279; C0H5Y3
• Molecular Weight: 59,872 Da
• NCBI Official Full Name: SLC11A1 protein
• NCBI Official Synonym Full Names: solute carrier family 11 (proton-coupled divalent metal ion transporter), member 1
• NCBI Official Symbol: SLC11A1
• NCBI Official Synonym Symbols: LSH; NRAMP; NRAMP1
• NCBI Protein Information: natural resistance-associated macrophage protein 1; NRAMP 1; solute carrier family 11 member 1; solute carrier family 11 (sodium/phosphate symporters), member 1; solute carrier family 11 (proton-coupled divalent metal ion transporters), member 1
• UniProt Protein Name: Natural resistance-associated macrophage protein 1
• Protein Family: Natural resistance-associated macrophage protein
• UniProt Gene Name: SLC11A1
• UniProt Synonym Gene Names: LSH; NRAMP; NRAMP1; NRAMP 1
• UniProt Entry Name: NRAM1_HUMAN

NCBI Description

This gene is a member of the solute carrier family 11 (proton-coupled divalent metal ion transporters) family and encodes a multi-pass membrane protein. The protein functions as a divalent transition metal (iron and manganese) transporter involved in iron metabolism and host resistance to certain pathogens. Mutations in this gene have been associated with susceptibility to infectious diseases such as tuberculosis and leprosy, and inflammatory diseases such as rheumatoid arthritis and Crohn disease. Alternatively spliced variants that encode different protein isoforms have been described but the full-length nature of only one has been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

SLC11A1: Divalent transition metal (iron and manganese) transporter involved in iron metabolism and host resistance to certain pathogens. Macrophage-specific membrane transport function. Controls natural resistance to infection with intracellular parasites. Pathogen resistance involves sequestration of Fe(2+) and Mn(2+), cofactors of both prokaryotic and eukaryotic catalases and superoxide dismutases, not only to protect the macrophage against its own generation of reactive oxygen species, but to deny the cations to the pathogen for synthesis of its protective enzymes. Belongs to the NRAMP family.

Protein type: Transporter; Membrane protein, integral; Cell surface; Vesicle; Transporter, SLC family; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 2q35

Cellular Component: phagocytic vesicle membrane; lysosome; integral to plasma membrane; late endosome membrane; late endosome; plasma membrane

Molecular Function: transition metal ion transmembrane transporter activity; protein homodimerization activity; manganese ion transmembrane transporter activity; metal ion:hydrogen antiporter activity

Biological Process: respiratory burst; wound healing; positive regulation of T-helper 1 type immune response; cellular iron ion homeostasis; positive regulation of dendritic cell antigen processing and presentation; manganese ion transport; response to lipopolysaccharide; defense response to Gram-negative bacterium; vacuolar acidification; antigen processing and presentation of peptide antigen; nitrite transport; T cell cytokine production; T cell proliferation during immune response; positive regulation of phagocytosis; interleukin-3 production; inflammatory response; transmembrane transport; positive regulation of cytokine production; interaction with host; mRNA stabilization; L-arginine import; defense response to protozoan; iron ion transport; interleukin-2 production; phagocytosis; iron ion homeostasis; cellular cadmium ion homeostasis; macrophage activation; positive regulation of interferon-gamma production; MHC class II biosynthetic process; response to bacterium; protein import into nucleus, translocation; defense response to bacterium; negative regulation of cytokine production; activation of protein kinase activity; positive regulation of transcription from RNA polymerase II promoter

Disease: Buruli Ulcer, Susceptibility To; Mycobacterium Tuberculosis, Susceptibility To