Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human GAL3ST4 Monoclonal Antibody | anti-GAL3ST4 antibody

GAL3ST4 (Galactose-3-O-sulfotransferase 4, Beta-galactose-3-O-sulfotransferase 4, Gal-beta-1,3-GalNAc 3'-sulfotransferase, FLJ12116, GAL3ST-4, PP6968)

Gene Names
GAL3ST4; GAL3ST-4
Reactivity
Human
Applications
ELISA
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
GAL3ST4; Monoclonal Antibody; GAL3ST4 (Galactose-3-O-sulfotransferase 4; Beta-galactose-3-O-sulfotransferase 4; Gal-beta-1; 3-GalNAc 3'-sulfotransferase; FLJ12116; GAL3ST-4; PP6968); Anti -GAL3ST4 (Galactose-3-O-sulfotransferase 4; anti-GAL3ST4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4E4
Specificity
Recognizes human GAL3ST4.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
RLQTAVAELRARREALAKHCLVGGEASDPKYITDRRFRPFQFGSAKVLGYILRSGLSPQDQEECERLATPELQYKDKLDAKQFPPTVSLPLKTSRPLSP
Applicable Applications for anti-GAL3ST4 antibody
ELISA (EL/EIA)
Application Notes
Suitable for use in ELISA.
Immunogen
Partial recombinant corresponding to aa388-487 from human GAL3ST4 (NP_078913) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Related Product Information for anti-GAL3ST4 antibody
Catalyzes the transfer of sulfate to beta-1,3-linked galactose residues in O-linked glycoproteins. Good substrates include asialofetuin, Gal-beta-1,3-GalNAc and Gal-beta-1,3 (GlcNAc-beta-1,6)GalNAc.
Product Categories/Family for anti-GAL3ST4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54,166 Da
NCBI Official Full Name
galactose-3-O-sulfotransferase 4
NCBI Official Synonym Full Names
galactose-3-O-sulfotransferase 4
NCBI Official Symbol
GAL3ST4
NCBI Official Synonym Symbols
GAL3ST-4
NCBI Protein Information
galactose-3-O-sulfotransferase 4; galbeta1-3GalNAc 3'-sulfotransferase; beta-galactose-3-O-sulfotransferase 4; beta-galactose-3-O-sulfotransferase, 4; gal-beta-1,3-GalNAc 3'-sulfotransferase
UniProt Protein Name
Galactose-3-O-sulfotransferase 4
UniProt Gene Name
GAL3ST4
UniProt Synonym Gene Names
Gal3ST-4
UniProt Entry Name
G3ST4_HUMAN

NCBI Description

This gene encodes a member of the galactose-3-O-sulfotransferase protein family. The product of this gene catalyzes sulfonation by transferring a sulfate to the C-3' position of galactose residues in O-linked glycoproteins. This enzyme is highly specific for core 1 structures, with asialofetuin, Gal-beta-1,3-GalNAc and Gal-beta-1,3 (GlcNAc-beta-1,6)GalNAc being good substrates. [provided by RefSeq, Jul 2008]

Uniprot Description

GAL3ST4: Catalyzes the transfer of sulfate to beta-1,3-linked galactose residues in O-linked glycoproteins. Good substrates include asialofetuin, Gal-beta-1,3-GalNAc and Gal-beta-1,3 (GlcNAc-beta-1,6)GalNAc. Belongs to the galactose-3-O-sulfotransferase family.

Protein type: Membrane protein, integral; Transferase; EC 2.8.2.-

Chromosomal Location of Human Ortholog: 7q22.1

Cellular Component: membrane; integral to membrane

Molecular Function: galactosylceramide sulfotransferase activity; 3'-phosphoadenosine 5'-phosphosulfate binding; proteoglycan sulfotransferase activity; galactose 3-O-sulfotransferase activity

Biological Process: sulfur metabolic process; glycoprotein metabolic process; cell-cell signaling; proteoglycan biosynthetic process; oligosaccharide metabolic process

Research Articles on GAL3ST4

Similar Products

Product Notes

The GAL3ST4 gal3st4 (Catalog #AAA6004827) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GAL3ST4 (Galactose-3-O-sulfotransferase 4, Beta-galactose-3-O-sulfotransferase 4, Gal-beta-1,3-GalNAc 3'-sulfotransferase, FLJ12116, GAL3ST-4, PP6968) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GAL3ST4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA). Suitable for use in ELISA. Researchers should empirically determine the suitability of the GAL3ST4 gal3st4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RLQTAVAELR ARREALAKHC LVGGEASDPK YITDRRFRPF QFGSAKVLGY ILRSGLSPQD QEECERLATP ELQYKDKLDA KQFPPTVSLP LKTSRPLSP. It is sometimes possible for the material contained within the vial of "GAL3ST4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.