Western Blot (WB)
(Western Blot detection against Immunogen (37.33kD).)
Mouse anti-Human SSBP3 Monoclonal Antibody | anti-SSBP3 antibody
SSBP3 (Single-stranded DNA-binding Protein 3, Sequence-specific Single-stranded-DNA-binding Protein, SSDP, SSDP1, CSDP)
Gene Names
SSBP3; CSDP; SSDP; SSDP1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
SSBP3; Monoclonal Antibody; SSBP3 (Single-stranded DNA-binding Protein 3; Sequence-specific Single-stranded-DNA-binding Protein; SSDP; SSDP1; CSDP); Anti -SSBP3 (Single-stranded DNA-binding Protein 3; anti-SSBP3 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3E6
Specificity
Recognizes human SSBP3.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MFAKGKGSAVPSDGQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRDTCEHSSEAKAFHDYSAAAAPSPVL*
Applicable Applications for anti-SSBP3 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa1-103 from SSBP3 (NP_060540) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (37.33kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (37.33kD).)
Testing Data
(Detection limit for recombinant GST tagged SSBP3 is ~0.3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged SSBP3 is ~0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-SSBP3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
40,421 Da
NCBI Official Full Name
SSBP3 protein, partial
NCBI Official Synonym Full Names
single stranded DNA binding protein 3
NCBI Official Symbol
SSBP3
NCBI Official Synonym Symbols
CSDP; SSDP; SSDP1
NCBI Protein Information
single-stranded DNA-binding protein 3; sequence-specific single-stranded-DNA-binding protein
UniProt Protein Name
Single-stranded DNA-binding protein 3
Protein Family
UniProt Gene Name
SSBP3
UniProt Synonym Gene Names
SSDP; SSDP1
UniProt Entry Name
SSBP3_HUMAN
Uniprot Description
SSBP3: May be involved in transcription regulation of the alpha 2(I) collagen gene where it binds to the single-stranded polypyrimidine sequences in the promoter region. 3 isoforms of the human protein are produced by alternative splicing.
Protein type: Transcription regulation; Cell cycle regulation; DNA-binding
Chromosomal Location of Human Ortholog: 1p32.3
Cellular Component: protein complex; nucleus
Molecular Function: single-stranded DNA binding
Biological Process: transcription, DNA-dependent; midbrain-hindbrain boundary initiation; positive regulation of cell proliferation; prechordal plate formation; positive regulation of transcription from RNA polymerase II promoter; protein complex assembly; hemopoietic progenitor cell differentiation
Research Articles on SSBP3
Similar Products
Product Notes
The SSBP3 ssbp3 (Catalog #AAA6001766) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SSBP3 (Single-stranded DNA-binding Protein 3, Sequence-specific Single-stranded-DNA-binding Protein, SSDP, SSDP1, CSDP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SSBP3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the SSBP3 ssbp3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MFAKGKGSAV PSDGQAREKL ALYVYEYLLH VGAQKSAQTF LSEIRWEKNI TLGEPPGFLH SWWCVFWDLY CAAPERRDTC EHSSEAKAFH DYSAAAAPSP VL*. It is sometimes possible for the material contained within the vial of "SSBP3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
