Mouse anti-Human DERL1 Monoclonal Antibody | anti-DERL1 antibody

DERL1 (Degradation In Endoplasmic Reticulum Protein 1, DERtrin-1, Der1-like Protein 1, Derlin-1, DER1, UNQ243/PRO276, FLJ13784, FLJ42092, MGC3067, PRO2577)

Cat. Num. AAA6000809

• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: DERL1; Monoclonal Antibody; DERL1 (Degradation In Endoplasmic Reticulum Protein 1; DERtrin-1; Der1-like Protein 1; Derlin-1; DER1; UNQ243/PRO276; FLJ13784; FLJ42092; MGC3067; PRO2577); Anti -DERL1 (Degradation In Endoplasmic Reticulum Protein 1; anti-DERL1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1B9
• Specificity: Recognizes human DERL1.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: AQLNRDMIVSFWFGTRFKACYLPWVILGFNYIIGGSVINELIGNLVGHLYFFLMFRYPMDLGGRNFLSTPQFLYRWLPSRRGGVSGFGVPPASMRRAADQ

• Applicable Applications for anti-DERL1 antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.
• Immunogen: Partial recombinant corresponding to aa134-233 from human DERL1 (AAH02457) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of MBS6000809 expression in HeLa.)

Related Product Information for anti-DERL1 antibody

Functional component of endoplasmic reticulum-associated degradation (ERAD) for misfolded lumenal proteins. DERL1 may act by forming a channel that allows the retrotranslocation of misfolded proteins into the cytosol where they are ubiquitinated and degraded by the proteasome. It may mediate the interaction between VCP and the degradation substrate. In case of infection by cytomegaloviruses, it plays a central role in the export from the ER and subsequent degradation of MHC class I heavy chains via its interaction with US11 viral protein, which recognizes and associates with MHC class I heavy chains. Also participates in the degradation process of misfolded cytomegalovirus US2 protein.

Product Categories/Family for anti-DERL1 antibody

Antibodies; Abs to Transport Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 45430007
• NCBI GeneID: 404121
• NCBI Accession #: NP_991358.1
• NCBI GenBank Nucleotide #: NM_205789.1
• UniProt Accession #: Q71SS4; Q1RMX8
• Molecular Weight: 28,865 Da
• NCBI Official Full Name: derlin-1
• NCBI Official Symbol: DERL1
• NCBI Protein Information: derlin-1; der1-like protein 1; Der1-like domain family, member 1; degradation in endoplasmic reticulum protein 1
• UniProt Protein Name: Derlin-1
• Protein Family: Probable derlin
• UniProt Gene Name: DERL1
• UniProt Synonym Gene Names: DER1
• UniProt Entry Name: DERL1_BOVIN

Uniprot Description

Function: Functional component of endoplasmic reticulum-associated degradation (ERAD) for misfolded lumenal proteins. May act by forming a channel that allows the retrotranslocation of misfolded proteins into the cytosol where they are ubiquitinated and degraded by the proteasome. May mediate the interaction between VCP and the degradation substrate

By similarity.

Subunit structure: Forms homo- and heterooligomers with DERL2 and DERL3; binding to DERL3 is poorer than that between DERL2 and DERL3. Interacts with AMFR, SELS/VIMP, SEL1L, SYVN1 and VCP, as well as with SEL1L-SYVN1 and VCP-SELS protein complexes; this interaction is weaker than that observed between DERL2 and these complexes. Interacts with NGLY1 and YOD1. Does not bind to EDEM1. Interacts with DNAJB9 and RNF103

By similarity.

Subcellular location: Endoplasmic reticulum membrane; Multi-pass membrane protein

By similarity.

Induction: Up-regulated in response to endoplasmic reticulum stress via the ERN1-XBP1 pathway of the unfolded protein response (UPR)

By similarity.

Sequence similarities: Belongs to the derlin family.