Rabbit anti-Human NR2E3 Polyclonal Antibody | anti-NR2E3 antibody

NR2E3 (PNR, RNR, Photoreceptor-specific Nuclear Receptor, Nuclear Receptor Subfamily 2 Group E Member 3, Retina-specific Nuclear Receptor)

Cat. Num. AAA6000438

• Gene Names: NR2E3; PNR; RNR; rd7; ESCS; RP37
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: NR2E3; Polyclonal Antibody; NR2E3 (PNR; RNR; Photoreceptor-specific Nuclear Receptor; Nuclear Receptor Subfamily 2 Group E Member 3; Retina-specific Nuclear Receptor); Anti -NR2E3 (PNR; anti-NR2E3 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human NR2E3.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: METRPTALMSSTVAAAAPAAGAASRKESPGRWGLGEDPTGVSPSLQCRVCGDSSSGKHYGIYACNGCSGFFKRSVRRRLIYRCQVGAGMCPVDKAHRNQCQACRLKKCLQAGMNQDAVQNERQPRSTAQVHLDSMESNTESRPESLVAPPAPAGRSPRGPTPMSAARALGHHFMASLITAETCAKLEPEDADENIDVTSNDPEFPSSPYSSSSPCGLDSIHETSARLLFMAVKWAKNLPVFSSLPFRDQVILLEEAWSELFLLGAIQWSLPLDSCPLLAPPEASAAGGAQGRLTLASMETRVLQETISRFRALAVDPTEFACMKALVLFKPETRGLKDPEHVEALQDQSQVMLSQHSKAHHPSQPVRFGKLLLLLPSLRFITAERIELLFFRKTIGNTPMEKLLCDMFKN

• Applicable Applications for anti-NR2E3 antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full length human NR2E3, aa1-410 (NP_055064.1).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of NR2E3 expression in transfected 293T cell line by NR2E3 polyclonal antibody. Lane 1: NR2E3 transfected lysate (44.7kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-NR2E3 antibody

This protein is part of a large family of nuclear receptor transcription factors involved in signaling pathways. Nuclear receptors have been shown to regulate pathways involved in embryonic development, as well as in maintenance of proper cell function in adults. Members of this family are characterized by discrete domains that function in DNA and ligand binding. This gene encodes a retinal nuclear receptor that is a ligand-dependent transcription factor. Defects in this gene are a cause of enhanced S cone syndrome. Alternatively spliced transcript variants encoding different isoforms have been identified.

Product Categories/Family for anti-NR2E3 antibody

Antibodies; Abs to Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 27371232
• NCBI GeneID: 10002
• UniProt Accession #: Q9Y5X4; Q9UHM4
• Molecular Weight: 44,692 Da
• NCBI Official Full Name: NR2E3 protein
• NCBI Official Synonym Full Names: nuclear receptor subfamily 2, group E, member 3
• NCBI Official Symbol: NR2E3
• NCBI Official Synonym Symbols: PNR; RNR; rd7; ESCS; RP37
• NCBI Protein Information: photoreceptor-specific nuclear receptor; retina-specific nuclear receptor
• UniProt Protein Name: Photoreceptor-specific nuclear receptor
• Protein Family: Photoreceptor-specific nuclear receptor
• UniProt Gene Name: NR2E3
• UniProt Synonym Gene Names: PNR; RNR
• UniProt Entry Name: NR2E3_HUMAN

NCBI Description

This protein is part of a large family of nuclear receptor transcription factors involved in signaling pathways. Nuclear receptors have been shown to regulate pathways involved in embryonic development, as well as in maintenance of proper cell function in adults. Members of this family are characterized by discrete domains that function in DNA and ligand binding. This gene encodes a retinal nuclear receptor that is a ligand-dependent transcription factor. Defects in this gene are a cause of enhanced S cone syndrome. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

NR2E3: Orphan nuclear receptor of retinal photoreceptor cells. Transcriptional factor that is an activator of rod development and repressor of cone development. Binds the promoter region of a number of rod- and cone-specific genes, including rhodopsin, M- and S-opsin and rod-specific phosphodiesterase beta subunit. Enhances rhodopsin expression. Represses M- and S-cone opsin expression. Defects in NR2E3 are a cause of enhanced S cone syndrome (ESCS). ESCS is an autosomal recessive retinopathy in which patients have increased sensitivity to blue light; perception of blue light is mediated by what is normally the least populous cone photoreceptor subtype, the S (short wavelength, blue) cones. ESCS is also associated with visual loss, with night blindness occurring from early in life, varying degrees of L (long, red)- and M (middle, green)-cone vision, and retinal degeneration. Defects in NR2E3 are the cause of retinitis pigmentosa type 37 (RP37). RP leads to degeneration of retinal photoreceptor cells. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well. RP37 inheritance is autosomal dominant. Belongs to the nuclear hormone receptor family. NR2 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nuclear receptor

Chromosomal Location of Human Ortholog: 15q23

Cellular Component: nucleoplasm; transcription factor complex; nucleus

Molecular Function: protein binding; ligand-dependent nuclear receptor activity; zinc ion binding; sequence-specific DNA binding; steroid hormone receptor activity

Biological Process: transcription from RNA polymerase II promoter; transcription initiation from RNA polymerase II promoter; intracellular receptor-mediated signaling pathway; positive regulation of rhodopsin gene expression; negative regulation of transcription from RNA polymerase II promoter; signal transduction; negative regulation of cell proliferation; eye photoreceptor cell development; visual perception; retina development in camera-type eye; phototransduction; positive regulation of transcription from RNA polymerase II promoter; gene expression; steroid hormone mediated signaling

Disease: Retinitis Pigmentosa 37; Enhanced S-cone Syndrome