Lin28-TAT recombinant protein
Human Lin28-TAT
Purity
>90% pure ( SDS-PAGE, Coomassie blue stain)
Synonyms
Lin28-TAT; Human Lin28-TAT; Lin28-TAT recombinant protein
Host
E Coli
Specificity
>90% pure ( SDS-PAGE, Coomassie blue stain)
Purity/Purification
>90% pure ( SDS-PAGE, Coomassie blue stain)
Form/Format
Purified, Liquid, filtered for cell culture. PBS with 50mM arginine
Concentration
1.0mg/ml (lot 11/2017) (varies by lot)
Sequence
HMGPSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPL
Application Notes
Stem Cell Study, Cell Biological Study
Species
Human
Protein Structure
Lin28 was expressed from E Coli, migrating around 27kDa on 10% SDS-PAGE with the purity 90%.
Preparation and Storage
Store in 4 degree C for short time only, aliquote to avoid repeated freezing and thawing, store at -20 degree C.
Related Product Information for Lin28-TAT recombinant protein
Lin28 is a RNA-binding protein that belongs to a diverse family of structurally-related transcription factors. Lin28 is found abundantly in embryonic stem cells (ESCs), and to a lesser extent in placenta and testis. Lin28 has been shown to block let-7 microRNA processing and maturation, a necessary step in the differentiation of stem cells and certain cancer cell lines. Together with Sox2, Oct4, and Nanog, Lin28 can induce the reprogramming of primary human fibroblasts to a pluripotent state. Lin28 and other regulatory proteins can be introduced into cells by DNA transfection, viral infection, or microinjection. Protein transduction using TAT fusion proteins represents an alternative methodology for introducing proteins into primary as well as transformed cells. Recombinant human Lin28-TAT is a 24.4 kDa protein containing 222 amino acid residues, including 13- residue C-terminal TAT peptide.
Product Categories/Family for Lin28-TAT recombinant protein
Similar Products
Product Notes
The Lin28-TAT (Catalog #AAA596155) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. Stem Cell Study, Cell Biological Study. Researchers should empirically determine the suitability of the Lin28-TAT for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: HMGPSVSNQQ FAGGCAKAAE EAPEEAPEDA ARAADEPQLL HGAGICKWFN VRMGFGFLSM TARAGVALDP PVDVFVHQSK LHMEGFRSLK EGEAVEFTFK KSAKGLESIR VTGPGGVFCI GSERRPKGKS MQKRRSKGDR CYNCGGLDHH AKECKLPPQP KKCHFCQSIS HMVASCPL. It is sometimes possible for the material contained within the vial of "Lin28-TAT, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
