Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human LCRMP4 Monoclonal Antibody | anti-LCRMP antibody

Anti-LCRMP4, 2H7

Reactivity
Human
Applications
ELISA
Purity
Protein G Affinity Purified
Synonyms
LCRMP4; Monoclonal Antibody; Anti-LCRMP4; 2H7; LCRMP; anti-LCRMP antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1, k
Clone Number
2H7
Specificity
LCRMP4
Purity/Purification
Protein G Affinity Purified
Form/Format
Lyophilized in a 0.01M pH7.2 phosphate buffer solution
Applicable Applications for anti-LCRMP antibody
ELISA (EIA)
Application Notes
Sandwich ELISA: In combination with anti-human IL-15 detection antibody clone B1H6 (Cat. No.: MBS592471), clone 5E8 can be used as capture antibody for quantitative measurement of IL-15 in ELISA.
Immunogen
The N-terminal 127 amino acids of LCRMP4.
Below is the amino acid sequence:
masgrrgwdssheddlpvylarpgttdqvprqkyggmfcnvegafesktldfdalsvgqrgaktprsgqgsdrgsgsrpgiegdtprrgqgreesrepapaspapagveirsatgkevlqnlgpkdk.
Target protein
Human LCRMP4
Fusion Myeloma
Sp2/0-Ag14
Reconstitution
Double distilled water is recommended to adjust the final concentration to 1.00 mg/mL.
Intended use
Primary antibody, can be used as capture antibody in immunoassay
Preparation and Storage
Store at -20 degree C
Related Product Information for anti-LCRMP antibody
Mouse monoclonal antibody against the long isoform of human Collapsin Response Mediator Protein 4 (LCRMP4), Clone 2H7. Mouse monoclonal antibody against the long isoform of human Collapsin Response Mediator Protein 4 (LCRMP4).

CRMP4 belongs to the collapsin response mediator protein (CRMP) family that includes CRMP 1-5. CRMPs are highly expressed in the nervous system during brain development. It is also found that CRMP4 is inversely associated with lymph node metastasis of prostate cancers and that the methylation of the CpG island within the promoter region of CRMP4 gene down- regulates CRMP4 expression (Xin Gao et al. 2010; Ke Li et al. 2015). Recently, Dr. Xin Gao's lab found that a long-form CRMP4 (LCRMP4) is potentially useful as a serum biomarker for prostate cancers.
Product Categories/Family for anti-LCRMP antibody
References
Xin Gao et al. Expression profiling identifies new function of collapsin response mediator protein 4 as a metastasis-suppressor in prostate cancer. Oncogene. 2010, 29, 4555–4566.
Ke Li et al. Manipulation of prostate cancer metastasis by locus-specific modification of the CRMP4 promoter region using chimeric TALE DNA methyltransferase and demethylase. Oncotarget. 2015, 6(12), 10030-10044.

Similar Products

Product Notes

The LCRMP (Catalog #AAA592475) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Anti-LCRMP4, 2H7 reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LCRMP4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Sandwich ELISA: In combination with anti-human IL-15 detection antibody clone B1H6 (Cat. No.: MBS592471), clone 5E8 can be used as capture antibody for quantitative measurement of IL-15 in ELISA. Researchers should empirically determine the suitability of the LCRMP for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LCRMP4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.