Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

beta-Endorphin, Inhibitor

beta-Endorphin, human

Purity
98.00%
Synonyms
beta-Endorphin; human; inhibitor
Ordering
For Research Use Only!
Purity/Purification
98.00%
Form/Format
Solid. Powder
Solubility
<1mg/ml refers to the product slightly soluble or insoluble
Formula
C158H251N39O46S
SMILES
[YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE]
CAS Number
61214-51-5
Target & IC50
Opioid receptor
Preparation and Storage
Store at -20 degree C for 3 years powder
-80 degree C for 2 years in solvent
Related Product Information for beta-Endorphin, inhibitor
beta-Endorphin, human, a prominent endogenous peptide, existing in the hypophysis cerebri and hypothalamus, and is an agonist of opioid receptor.
Product Categories/Family for beta-Endorphin, inhibitor
References
Narita M, et al. Evidence for the existence of the beta-endorphin-sensitive "epsilon-opioid receptor" in the brain: the mechanisms of epsilon-mediated antinociception. Jpn J Pharmacol. 1998 Mar;76(3):233-53.
Narita M, et al. Evidence for the existence of the beta-endorphin-sensitive "epsilon-opioid receptor" in the brain: the mechanisms of epsilon-mediated antinociception. Jpn J Pharmacol. 1998 Mar;76(3):233-53.
Luan YH, et al. Action of beta-endorphin and nonsteroidal anti-inflammatory drugs, and the possible effects of nonsteroidal anti-inflammatory drugs on beta-endorphin. J Clin Anesth. 2017 Feb;37:123-128.
Luan YH, et al. Action of beta-endorphin and nonsteroidal anti-inflammatory drugs, and the possible effects of nonsteroidal anti-inflammatory drugs on beta-endorphin. J Clin Anesth. 2017 Feb;37:123-128.

Similar Products

Product Notes

The beta-Endorphin (Catalog #AAA5754184) is an Inhibitor and is intended for research purposes only. The product is available for immediate purchase. It is sometimes possible for the material contained within the vial of "beta-Endorphin, Inhibitor" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.